KEGG   Homo sapiens (human): 7422Help
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
vascular endothelial growth factor A
Orthology
K05448  
vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Disease
H00018  
Gastric cancer
Drug target
Bevacizumab: 
Aflibercept: 
Pegaptanib: 
Ranibizumab: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 412 aa AA seqDB search
MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG
CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT
GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ctgacggacagacagacagacaccgcccccagccccagctaccacctcctccccggccgg
cggcggacagtggacgcggcggcgagccgcgggcaggggccggagcccgcgcccggaggc
ggggtggagggggtcggggctcgcggcgtcgcactgaaacttttcgtccaacttctgggc
tgttctcgcttcggaggagccgtggtccgcgcgggggaagccgagccgagcggagccgcg
agaagtgctagctcgggccgggaggagccgcagccggaggagggggaggaggaagaagag
aaggaagaggagagggggccgcagtggcgactcggcgctcggaagccgggctcatggacg
ggtgaggcggcggtgtgcgcagacagtgctccagccgcgcgcgctccccaggccctggcc
cgggcctcgggccggggaggaagagtagctcgccgaggcgccgaggagagcgggccgccc
cacagcccgagccggagagggagcgcgagccgcgccggccccggtcgggcctccgaaacc
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system