KEGG   Homo sapiens (human): 7422Help
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
vascular endothelial growth factor A
Orthology
K05448  
vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Disease
H00018  
Gastric cancer
Drug target
Bevacizumab: 
Aflibercept: 
Pegaptanib: 
Ranibizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7422 (VEGFA)
   04015 Rap1 signaling pathway
    7422 (VEGFA)
   04370 VEGF signaling pathway
    7422 (VEGFA)
   04066 HIF-1 signaling pathway
    7422 (VEGFA)
   04151 PI3K-Akt signaling pathway
    7422 (VEGFA)
   04150 mTOR signaling pathway
    7422 (VEGFA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7422 (VEGFA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7422 (VEGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7422 (VEGFA)
   05206 MicroRNAs in cancer
    7422 (VEGFA)
   05205 Proteoglycans in cancer
    7422 (VEGFA)
   05212 Pancreatic cancer
    7422 (VEGFA)
   05211 Renal cell carcinoma
    7422 (VEGFA)
   05219 Bladder cancer
    7422 (VEGFA)
  Immune diseases
   05323 Rheumatoid arthritis
    7422 (VEGFA)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7422 (VEGFA)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  7422 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 412 aa AA seqDB search
MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG
CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT
GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ctgacggacagacagacagacaccgcccccagccccagctaccacctcctccccggccgg
cggcggacagtggacgcggcggcgagccgcgggcaggggccggagcccgcgcccggaggc
ggggtggagggggtcggggctcgcggcgtcgcactgaaacttttcgtccaacttctgggc
tgttctcgcttcggaggagccgtggtccgcgcgggggaagccgagccgagcggagccgcg
agaagtgctagctcgggccgggaggagccgcagccggaggagggggaggaggaagaagag
aaggaagaggagagggggccgcagtggcgactcggcgctcggaagccgggctcatggacg
ggtgaggcggcggtgtgcgcagacagtgctccagccgcgcgcgctccccaggccctggcc
cgggcctcgggccggggaggaagagtagctcgccgaggcgccgaggagagcgggccgccc
cacagcccgagccggagagggagcgcgagccgcgccggccccggtcgggcctccgaaacc
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system