KEGG   Homo sapiens (human): 7422Help
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  
vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
VEGF signaling pathway
Focal adhesion
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Pancreatic cancer
Bladder cancer
Rheumatoid arthritis
Disease
H00018  
Gastric cancer
H01456  
Diabetic nephropathy
H01457  
Diabetic retinopathy
H01459  
Diabetic neuropathy
H01529  
Avascular necrosis of femoral head
Drug target
Bevacizumab: 
Aflibercept: 
Pegaptanib: 
Ranibizumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    7422 (VEGFA)
   04015 Rap1 signaling pathway
    7422 (VEGFA)
   04370 VEGF signaling pathway
    7422 (VEGFA)
   04066 HIF-1 signaling pathway
    7422 (VEGFA)
   04151 PI3K-Akt signaling pathway
    7422 (VEGFA)
   04150 mTOR signaling pathway
    7422 (VEGFA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7422 (VEGFA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7422 (VEGFA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7422 (VEGFA)
   05206 MicroRNAs in cancer
    7422 (VEGFA)
   05205 Proteoglycans in cancer
    7422 (VEGFA)
   05212 Pancreatic cancer
    7422 (VEGFA)
   05211 Renal cell carcinoma
    7422 (VEGFA)
   05219 Bladder cancer
    7422 (VEGFA)
  Immune diseases
   05323 Rheumatoid arthritis
    7422 (VEGFA)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    7422 (VEGFA)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    7422 (VEGFA)
Cytokines [BR:hsa04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    7422 (VEGFA)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP1; neuropilin 1 [KO:K06724]
   7422 (VEGFA)
  NRP2; neuropilin 2 [KO:K06819]
   7422 (VEGFA)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   7422 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p12
AA seq 232 aa AA seqDB search
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system