KEGG   Homo sapiens (human): 7430Help
Entry
7430              CDS       T01001                                 

Gene name
EZR, CVIL, CVL, HEL-S-105, VIL2
Definition
(RefSeq) ezrin
  KO
K08007  villin 2 (ezrin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04971  Gastric acid secretion
hsa05130  Pathogenic Escherichia coli infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    7430 (EZR)
  Cell motility
   04810 Regulation of actin cytoskeleton
    7430 (EZR)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7430 (EZR)
  Digestive system
   04971 Gastric acid secretion
    7430 (EZR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7430 (EZR)
   05205 Proteoglycans in cancer
    7430 (EZR)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7430 (EZR)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     7430 (EZR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7430 (EZR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Motif
Other DBs
NCBI-GeneID: 7430
NCBI-ProteinID: NP_001104547
OMIM: 123900
HGNC: 12691
Ensembl: ENSG00000092820
Vega: OTTHUMG00000015917
Pharos: P15311(Tbio)
UniProt: P15311
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 586 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtaaagactatcggcctccgg
gaagtgtggtactttggcctccactatgtggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggaaggaatccttagcgatgagatctactgcccccctgag
actgccgtgctcttggggtcctacgctgtgcaggccaagtttggggactacaacaaagaa
gtgcacaagtctgggtacctcagctctgagcggctgatccctcaaagagtgatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgt
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttggactgaatatttatgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccacgtctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagttgtatatgcgccgcaggaagcctgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgcgagaaggaggagttgatgctgcggctgcaggactatgaggagaagacaaagaag
gcagagagagagctctcggagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaagttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacagcacccccgcccccaccaccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcagagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacgctgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gacgagttcgaggccctgtaa

DBGET integrated database retrieval system