KEGG   Homo sapiens (human): 7430Help
Entry
7430              CDS       T01001                                 

Gene name
EZR, CVIL, CVL, VIL2
Definition
ezrin
Orthology
K08007  
villin 2 (ezrin)
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Gastric acid secretion
Pathogenic Escherichia coli infection
Proteoglycans in cancer
MicroRNAs in cancer
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 586 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtaaagactatcggcctccgg
gaagtgtggtactttggcctccactatgtggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggaaggaatccttagcgatgagatctactgcccccctgag
actgccgtgctcttggggtcctacgctgtgcaggccaagtttggggactacaacaaagaa
gtgcacaagtctgggtacctcagctctgagcggctgatccctcaaagagtgatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgt
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttggactgaatatttatgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccacgtctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagttgtatatgcgccgcaggaagcctgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgcgagaaggaggagttgatgctgcggctgcaggactatgaggagaagacaaagaag
gcagagagagagctctcggagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaagttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacagcacccccgcccccaccaccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcagagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacgctgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gacgagttcgaggccctgtaa

DBGET integrated database retrieval system