KEGG   Homo sapiens (human): 7430Help
Entry
7430              CDS       T01001                                 

Gene name
EZR, CVIL, CVL, HEL-S-105, VIL2
Definition
ezrin
Orthology
K08007  
villin 2 (ezrin)
Organism
hsa  Homo sapiens (human)
Pathway
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Gastric acid secretion
Pathogenic Escherichia coli infection
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    7430 (EZR)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7430 (EZR)
  Digestive system
   04971 Gastric acid secretion
    7430 (EZR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    7430 (EZR)
   05205 Proteoglycans in cancer
    7430 (EZR)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7430 (EZR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7430 (EZR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.3
AA seq 586 aa AA seqDB search
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtaaagactatcggcctccgg
gaagtgtggtactttggcctccactatgtggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggaaggaatccttagcgatgagatctactgcccccctgag
actgccgtgctcttggggtcctacgctgtgcaggccaagtttggggactacaacaaagaa
gtgcacaagtctgggtacctcagctctgagcggctgatccctcaaagagtgatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgt
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttggactgaatatttatgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccacgtctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagttgtatatgcgccgcaggaagcctgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgcgagaaggaggagttgatgctgcggctgcaggactatgaggagaagacaaagaag
gcagagagagagctctcggagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaagttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacagcacccccgcccccaccaccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcagagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacgctgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gacgagttcgaggccctgtaa

DBGET integrated database retrieval system