KEGG   Homo sapiens (human): 7448Help
Entry
7448              CDS       T01001                                 

Gene name
VTN, V75, VN, VNT
Definition
(RefSeq) vitronectin
  KO
K06251  
vitronectin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7448 (VTN)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7448 (VTN)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7448 (VTN)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    7448 (VTN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7448 (VTN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7448 (VTN)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7448 (VTN)
   alpha V beta 1
     7448 (VTN)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     7448 (VTN)
   VNR
     7448 (VTN)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7448 (VTN)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7448 (VTN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   7448 (VTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P04004(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 478 aa AA seqDB search
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctgagaccccttctcatactggccctgctggcatgggttgctctggctgac
caagagtcatgcaagggccgctgcactgagggcttcaacgtggacaagaagtgccagtgt
gacgagctctgctcttactaccagagctgctgcacagactatacggctgagtgcaagccc
caagtgactcgcggggatgtgttcactatgccggaggatgagtacacggtctatgacgat
ggcgaggagaaaaacaatgccactgtccatgaacaggtggggggcccctccctgacctct
gacctccaggcccagtccaaagggaatcctgagcagacacctgttctgaaacctgaggaa
gaggcccctgcgcctgaggtgggcgcctctaagcctgaggggatagactcaaggcctgag
acccttcatccagggagacctcagcccccagcagaggaggagctgtgcagtgggaagccc
ttcgacgccttcaccgacctcaagaacggttccctctttgccttccgagggcagtactgc
tatgaactggacgaaaaggcagtgaggcctgggtaccccaagctcatccgagatgtctgg
ggcatcgagggccccatcgatgccgccttcacccgcatcaactgtcaggggaagacctac
ctcttcaagggtagtcagtactggcgctttgaggatggtgtcctggaccctgattacccc
cgaaatatctctgacggcttcgatggcatcccggacaacgtggatgcagccttggccctc
cctgcccatagctacagtggccgggagcgggtctacttcttcaaggggaaacagtactgg
gagtaccagttccagcaccagcccagtcaggaggagtgtgaaggcagctccctgtcggct
gtgtttgaacactttgccatgatgcagcgggacagctgggaggacatcttcgagcttctc
ttctggggcagaacctctgctggtaccagacagccccagttcattagccgggactggcac
ggtgtgccagggcaagtggacgcagccatggctggccgcatctacatctcaggcatggca
ccccgcccctccttggccaagaaacaaaggtttaggcatcgcaaccgcaaaggctaccgt
tcacaacgaggccacagccgtggccgcaaccagaactcccgccggccatcccgcgccacg
tggctgtccttgttctccagtgaggagagcaacttgggagccaacaactatgatgactac
aggatggactggcttgtgcctgccacctgtgaacccatccagagtgtcttcttcttctct
ggagacaagtactaccgagtcaatcttcgcacacggcgagtggacactgtggaccctccc
tacccacgctccatcgctcagtactggctgggctgcccagctcctggccatctgtag

DBGET integrated database retrieval system