KEGG   Homo sapiens (human): 7448Help
Entry
7448              CDS       T01001                                 

Gene name
VTN, V75, VN, VNT
Definition
vitronectin
Orthology
K06251  
vitronectin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7448 (VTN)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7448 (VTN)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    7448 (VTN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7448 (VTN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7448 (VTN)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  7448 (VTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q11
AA seq 478 aa AA seqDB search
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctgagaccccttctcatactggccctgctggcatgggttgctctggctgac
caagagtcatgcaagggccgctgcactgagggcttcaacgtggacaagaagtgccagtgt
gacgagctctgctcttactaccagagctgctgcacagactatacggctgagtgcaagccc
caagtgactcgcggggatgtgttcactatgccggaggatgagtacacggtctatgacgat
ggcgaggagaaaaacaatgccactgtccatgaacaggtggggggcccctccctgacctct
gacctccaggcccagtccaaagggaatcctgagcagacacctgttctgaaacctgaggaa
gaggcccctgcgcctgaggtgggcgcctctaagcctgaggggatagactcaaggcctgag
acccttcatccagggagacctcagcccccagcagaggaggagctgtgcagtgggaagccc
ttcgacgccttcaccgacctcaagaacggttccctctttgccttccgagggcagtactgc
tatgaactggacgaaaaggcagtgaggcctgggtaccccaagctcatccgagatgtctgg
ggcatcgagggccccatcgatgccgccttcacccgcatcaactgtcaggggaagacctac
ctcttcaagggtagtcagtactggcgctttgaggatggtgtcctggaccctgattacccc
cgaaatatctctgacggcttcgatggcatcccggacaacgtggatgcagccttggccctc
cctgcccatagctacagtggccgggagcgggtctacttcttcaaggggaaacagtactgg
gagtaccagttccagcaccagcccagtcaggaggagtgtgaaggcagctccctgtcggct
gtgtttgaacactttgccatgatgcagcgggacagctgggaggacatcttcgagcttctc
ttctggggcagaacctctgctggtaccagacagccccagttcattagccgggactggcac
ggtgtgccagggcaagtggacgcagccatggctggccgcatctacatctcaggcatggca
ccccgcccctccttggccaagaaacaaaggtttaggcatcgcaaccgcaaaggctaccgt
tcacaacgaggccacagccgtggccgcaaccagaactcccgccggccatcccgcgccacg
tggctgtccttgttctccagtgaggagagcaacttgggagccaacaactatgatgactac
aggatggactggcttgtgcctgccacctgtgaacccatccagagtgtcttcttcttctct
ggagacaagtactaccgagtcaatcttcgcacacggcgagtggacactgtggaccctccc
tacccacgctccatcgctcagtactggctgggctgcccagctcctggccatctgtag

DBGET integrated database retrieval system