KEGG   Homo sapiens (human): 7448Help
Entry
7448              CDS       T01001                                 

Gene name
VTN, V75, VN, VNT
Definition
(RefSeq) vitronectin
  KO
K06251  
vitronectin
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Human papillomavirus infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    7448 (VTN)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    7448 (VTN)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    7448 (VTN)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    7448 (VTN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    7448 (VTN)
  Infectious diseases
   05165 Human papillomavirus infection
    7448 (VTN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7448 (VTN)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-8
    ITGB1; integrin beta 1 [KO:K05719]
     7448 (VTN)
   alpha V beta 1
     7448 (VTN)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     7448 (VTN)
   VNR
     7448 (VTN)
  Beta5 integrins
   alpha V beta 5
    ITGB5; integrin beta 5 [KO:K06588]
     7448 (VTN)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     7448 (VTN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   7448 (VTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P04004(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q11.2
AA seq 478 aa AA seqDB search
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctgagaccccttctcatactggccctgctggcatgggttgctctggctgac
caagagtcatgcaagggccgctgcactgagggcttcaacgtggacaagaagtgccagtgt
gacgagctctgctcttactaccagagctgctgcacagactatacggctgagtgcaagccc
caagtgactcgcggggatgtgttcactatgccggaggatgagtacacggtctatgacgat
ggcgaggagaaaaacaatgccactgtccatgaacaggtggggggcccctccctgacctct
gacctccaggcccagtccaaagggaatcctgagcagacacctgttctgaaacctgaggaa
gaggcccctgcgcctgaggtgggcgcctctaagcctgaggggatagactcaaggcctgag
acccttcatccagggagacctcagcccccagcagaggaggagctgtgcagtgggaagccc
ttcgacgccttcaccgacctcaagaacggttccctctttgccttccgagggcagtactgc
tatgaactggacgaaaaggcagtgaggcctgggtaccccaagctcatccgagatgtctgg
ggcatcgagggccccatcgatgccgccttcacccgcatcaactgtcaggggaagacctac
ctcttcaagggtagtcagtactggcgctttgaggatggtgtcctggaccctgattacccc
cgaaatatctctgacggcttcgatggcatcccggacaacgtggatgcagccttggccctc
cctgcccatagctacagtggccgggagcgggtctacttcttcaaggggaaacagtactgg
gagtaccagttccagcaccagcccagtcaggaggagtgtgaaggcagctccctgtcggct
gtgtttgaacactttgccatgatgcagcgggacagctgggaggacatcttcgagcttctc
ttctggggcagaacctctgctggtaccagacagccccagttcattagccgggactggcac
ggtgtgccagggcaagtggacgcagccatggctggccgcatctacatctcaggcatggca
ccccgcccctccttggccaagaaacaaaggtttaggcatcgcaaccgcaaaggctaccgt
tcacaacgaggccacagccgtggccgcaaccagaactcccgccggccatcccgcgccacg
tggctgtccttgttctccagtgaggagagcaacttgggagccaacaactatgatgactac
aggatggactggcttgtgcctgccacctgtgaacccatccagagtgtcttcttcttctct
ggagacaagtactaccgagtcaatcttcgcacacggcgagtggacactgtggaccctccc
tacccacgctccatcgctcagtactggctgggctgcccagctcctggccatctgtag

DBGET integrated database retrieval system