KEGG   Homo sapiens (human): 7465Help
Entry
7465              CDS       T01001                                 

Gene name
WEE1, WEE1A, WEE1hu
Definition
WEE1 G2 checkpoint kinase (EC:2.7.10.2)
Orthology
K06632  
wee1-like protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7465 (WEE1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7465 (WEE1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  WEE family
   7465 (WEE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 432 aa AA seqDB search
MDTEKSGKREFDVRQTPQVNINPFTPDSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYEL
EDETRPAKRITITESNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPL
AGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRI
MSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWAS
NKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAE
PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASR
KSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIG
KKMNRSVSLTIY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatacagaaaaatcaggaaaaagggaatttgatgtgcgacagactcctcaagtgaat
attaatccttttactccggattctttgttgcttcattcctcaggacagtgtcgtcgtaga
aagagaacgtattggaatgattcctgtggtgaagacatggaagccagtgattatgagctt
gaagatgaaacaagacctgctaagagaattacaattactgaaagcaatatgaagtcccgg
tatacaacagaatttcatgagctagagaaaatcggctctggagaatttggttctgtattt
aagtgtgtgaagaggctggatggatgcatttatgccattaagcgatcaaaaaagccattg
gcgggctctgttgatgagcagaacgctttgagagaagtatatgctcatgcagtgcttgga
cagcattctcatgtagttcgatatttctctgcgtgggcagaagatgatcatatgcttata
cagaatgaatattgtaatggtggaagtttagctgatgctataagtgaaaactacagaatc
atgagttactttaaagaagcagagttgaaggatctccttttgcaagttggccgaggcttg
aggtatattcattcaatgtctttggttcacatggatataaaacctagtaatattttcata
tctcgaacctcaatcccaaatgctgcctctgaagaaggagacgaagatgattgggcatcc
aacaaagttatgtttaaaataggtgatcttgggcatgtaacaaggatctccagtccacaa
gttgaagagggcgatagtcgttttcttgcaaatgaagttttacaggagaattatacccat
ctaccaaaagcagatatttttgcgcttgccctcacagtggtatgtgctgctggtgctgaa
cctcttccgagaaatggagatcaatggcatgaaatcagacagggtagattacctcggata
ccacaagtgctttcccaagaatttacagagttgctaaaagttatgattcatccagatcca
gagagaagaccttcagcaatggcactggtaaagcattcagtattgctgtccgcttctaga
aagagtgcagaacaattacgaatagaattgaatgccgaaaagttcaaaaattcactttta
caaaaagaactcaagaaagcacagatggcaaaagctgcagctgaggaaagagcactcttc
actgaccggatggccactaggtccaccacccagagtaatagaacatctcgacttattgga
aagaaaatgaaccgctctgtcagccttactatatactga

DBGET integrated database retrieval system