KEGG   Homo sapiens (human): 7529Help
Entry
7529              CDS       T01001                                 

Gene name
YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7529 (YWHAB)
   04151 PI3K-Akt signaling pathway
    7529 (YWHAB)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7529 (YWHAB)
   04114 Oocyte meiosis
    7529 (YWHAB)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7529 (YWHAB)
  Infectious diseases
   05161 Hepatitis B
    7529 (YWHAB)
   05169 Epstein-Barr virus infection
    7529 (YWHAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7529 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.1
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcga
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaac
gaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcc
tggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaa
caaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatg
cagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagac
gctggggagggagagaactaa

DBGET integrated database retrieval system