KEGG   Homo sapiens (human): 7531Help
Entry
7531              CDS       T01001                                 

Gene name
YWHAE, 14-3-3E, HEL2, KCIP-1, MDCR, MDS
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
  KO
K06630  14-3-3 protein epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
N00269  HCV Core to host-cell-protein activation
Disease
H00268  Lissencephaly (LIS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7531 (YWHAE)
   04151 PI3K-Akt signaling pathway
    7531 (YWHAE)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7531 (YWHAE)
   04114 Oocyte meiosis
    7531 (YWHAE)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    7531 (YWHAE)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7531 (YWHAE)
  Infectious diseases
   05169 Epstein-Barr virus infection
    7531 (YWHAE)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7531 (YWHAE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7531 (YWHAE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 Orbi_VP5
Motif
Other DBs
NCBI-GeneID: 7531
NCBI-ProteinID: NP_006752
OMIM: 605066
HGNC: 12851
Ensembl: ENSG00000108953
Vega: OTTHUMG00000134316
Pharos: P62258(Tbio)
UniProt: P62258 V9HW98
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 255 aa AA seqDB search
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcgagaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagctgacagttgaa
gaaagaaacctcctatctgttgcatataagaatgtgattggagctagaagagcctcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaagctaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggcagaatttgccacaggaaacgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacgcatcctattcgcttaggtcttgctctcaatttttccgtattc
tactacgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggatacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgacggtgaa
gagcagaataaagaagcgctgcaggacgtggaagacgaaaatcagtga

DBGET integrated database retrieval system