KEGG   Homo sapiens (human): 7533Help
Entry
7533              CDS       T01001                                 

Gene name
YWHAH, YWHA1
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Orthology
K16198  
14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7533 (YWHAH)
   04151 PI3K-Akt signaling pathway
    7533 (YWHAH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7533 (YWHAH)
   04114 Oocyte meiosis
    7533 (YWHAH)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7533 (YWHAH)
  Infectious diseases
   05169 Epstein-Barr virus infection
    7533 (YWHAH)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7533 (YWHAH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7533 (YWHAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q12.3
AA seq 246 aa AA seqDB search
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgctatgaaggcggtgacagagctgaatgaacctctctccaatgaa
gatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcattagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaagggtgattactaccgctacttagcagaggtcgcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatc
agcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctcc
gtgttctactatgagatccagaatgcacctgagcaagcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctgatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

DBGET integrated database retrieval system