KEGG   Homo sapiens (human): 7534Help
Entry
7534              CDS       T01001                                 

Gene name
YWHAZ, 14-3-3-zeta, HEL-S-3, HEL4, KCIP-1, YWHAD
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Pathogenic Escherichia coli infection
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7534 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    7534 (YWHAZ)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7534 (YWHAZ)
   04114 Oocyte meiosis
    7534 (YWHAZ)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7534 (YWHAZ)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7534 (YWHAZ)
   05161 Hepatitis B
    7534 (YWHAZ)
   05169 Epstein-Barr virus infection
    7534 (YWHAZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7534 (YWHAZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23.1
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system