KEGG   Homo sapiens (human): 7534Help
Entry
7534              CDS       T01001                                 

Gene name
YWHAZ, 14-3-3-zeta, HEL-S-3, HEL4, KCIP-1, YWHAD
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Pathogenic Escherichia coli infection
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q23.1
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system