KEGG   Homo sapiens (human): 7535Help
Entry
7535              CDS       T01001                                 

Gene name
ZAP70, SRK, STCD, STD, TZK, ZAP-70
Definition
zeta-chain (TCR) associated protein kinase 70kDa (EC:2.7.10.2)
Orthology
K07360  
tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
NF-kappa B signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12
AA seq 619 aa AA seqDB search
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccccgcggcgcacctgcccttcttctacggcagcatctcgcgtgccgaggcc
gaggagcacctgaagctggcgggcatggcggacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctgtcgctcgtgcacgatgtgcgcttccaccactttccc
atcgagcgccagctcaacggcacctacgccattgccggcggcaaagcgcactgtggaccg
gcagagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgcaag
ccgtgcaaccggccgtcgggcctcgagccgcagccgggggtcttcgactgcctgcgagac
gccatggtgcgtgactacgtgcgccagacgtggaagctggagggcgaggccctggagcag
gccatcatcagccaggccccgcaggtggagaagctcattgctacgacggcccacgagcgg
atgccctggtaccacagcagcctgacgcgtgaggaggccgagcgcaaactttactctggg
gcgcagaccgacggcaagttcctgctgaggccgcggaaggagcagggcacatacgccctg
tccctcatctatgggaagacggtgtaccactacctcatcagccaagacaaggcgggcaag
tactgcattcccgagggcaccaagtttgacacgctctggcagctggtggagtatctgaag
ctgaaggcggacgggctcatctactgcctgaaggaggcctgccccaacagcagtgccagc
aacgcctcaggggctgctgctcccacactcccagcccacccatccacgttgactcatcct
cagagacgaatcgacaccctcaactcagatggatacacccctgagccagcacgcataacg
tccccagacaaaccgcggccgatgcccatggacacgagcgtgtatgagagcccctacagc
gacccagaggagctcaaggacaagaagctcttcctgaagcgcgataacctcctcatagct
gacattgaacttggctgcggcaactttggctcagtgcgccagggcgtgtaccgcatgcgc
aagaagcagatcgacgtggccatcaaggtgctgaagcagggcacggagaaggcagacacg
gaagagatgatgcgcgaggcgcagatcatgcaccagctggacaacccctacatcgtgcgg
ctcattggcgtctgccaggccgaggccctcatgctggtcatggagatggctgggggcggg
ccgctgcacaagttcctggtcggcaagagggaggagatccctgtgagcaatgtggccgag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaactttgtgcaccgt
gacctggcggcccgcaacgtcctgctggttaaccggcactacgccaagatcagcgacttt
ggcctctccaaagcactgggtgccgacgacagctactacactgcccgctcagcagggaag
tggccgctcaagtggtacgcacccgaatgcatcaacttccgcaagttctccagccgcagc
gatgtctggagctatggggtcaccatgtgggaggccttgtcctacggccagaagccctac
aagaagatgaaagggccggaggtcatggccttcatcgagcagggcaagcggatggagtgc
ccaccagagtgtccacccgaactgtacgcactcatgagtgactgctggatctacaagtgg
gaggatcgccccgacttcctgaccgtggagcagcgcatgcgagcctgttactacagcctg
gccagcaaggtggaagggcccccaggcagcacacagaaggctgaggctgcctgtgcctga

DBGET integrated database retrieval system