KEGG   Homo sapiens (human): 7852Help
Entry
7852              CDS       T01001                                 

Gene name
CXCR4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP-3, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM
Definition
chemokine (C-X-C motif) receptor 4
Orthology
K04189  
C-X-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Axon guidance
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Disease
H00097  
Chemokine receptor defect
Drug target
Plerixafor: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7852 (CXCR4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    7852 (CXCR4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    7852 (CXCR4)
   04672 Intestinal immune network for IgA production
    7852 (CXCR4)
   04062 Chemokine signaling pathway
    7852 (CXCR4)
  Development
   04360 Axon guidance
    7852 (CXCR4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    7852 (CXCR4)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   7852 (CXCR4)
Cellular antigens [BR:hsa04090]
 Proteins
  7852 (CXCR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q21
AA seq 356 aa AA seqDB search
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN
GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY
TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFAN
VSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK
ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCC
LNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcctttgcctcttttgcagatatacacttcagataactacaccgaggaaatg
ggctcaggggactatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttc
aataaaatcttcctgcccaccatctactccatcatcttcttaactggcattgtgggcaat
ggattggtcatcctggtcatgggttaccagaagaaactgagaagcatgacggacaagtac
aggctgcacctgtcagtggccgacctcctctttgtcatcacgcttcccttctgggcagtt
gatgccgtggcaaactggtactttgggaacttcctatgcaaggcagtccatgtcatctac
acagtcaacctctacagcagtgtcctcatcctggccttcatcagtctggaccgctacctg
gccatcgtccacgccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtc
tatgttggcgtctggatccctgccctcctgctgactattcccgacttcatctttgccaac
gtcagtgaggcagatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtg
gttgtgttccagtttcagcacatcatggttggccttatcctgcctggtattgtcatcctg
tcctgctattgcattatcatctccaagctgtcacactccaagggccaccagaagcgcaag
gccctcaagaccacagtcatcctcatcctggctttcttcgcctgttggctgccttactac
attgggatcagcatcgactccttcatcctcctggaaatcatcaagcaagggtgtgagttt
gagaacactgtgcacaagtggatttccatcaccgaggccctagctttcttccactgttgt
ctgaaccccatcctctatgctttccttggagccaaatttaaaacctctgcccagcacgca
ctcacctctgtgagcagagggtccagcctcaagatcctctccaaaggaaagcgaggtgga
cattcatctgtttccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system