KEGG   Homo sapiens (human): 7852Help
Entry
7852              CDS       T01001                                 

Gene name
CXCR4, CD184, D2S201E, FB22, HM89, HSY3RR, LAP3, LCR1, LESTR, NPY3R, NPYR, NPYRL, NPYY3R, WHIM
Definition
chemokine (C-X-C motif) receptor 4
Orthology
K04189  
C-X-C chemokine receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Endocytosis
Axon guidance
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Disease
H00097  
Chemokine receptor defect
Drug target
Plerixafor: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:hsa04672]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q21
AA seq 356 aa AA seqDB search
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN
GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY
TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFAN
VSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK
ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCC
LNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtccattcctttgcctcttttgcagatatacacttcagataactacaccgaggaaatg
ggctcaggggactatgactccatgaaggaaccctgtttccgtgaagaaaatgctaatttc
aataaaatcttcctgcccaccatctactccatcatcttcttaactggcattgtgggcaat
ggattggtcatcctggtcatgggttaccagaagaaactgagaagcatgacggacaagtac
aggctgcacctgtcagtggccgacctcctctttgtcatcacgcttcccttctgggcagtt
gatgccgtggcaaactggtactttgggaacttcctatgcaaggcagtccatgtcatctac
acagtcaacctctacagcagtgtcctcatcctggccttcatcagtctggaccgctacctg
gccatcgtccacgccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtc
tatgttggcgtctggatccctgccctcctgctgactattcccgacttcatctttgccaac
gtcagtgaggcagatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtg
gttgtgttccagtttcagcacatcatggttggccttatcctgcctggtattgtcatcctg
tcctgctattgcattatcatctccaagctgtcacactccaagggccaccagaagcgcaag
gccctcaagaccacagtcatcctcatcctggctttcttcgcctgttggctgccttactac
attgggatcagcatcgactccttcatcctcctggaaatcatcaagcaagggtgtgagttt
gagaacactgtgcacaagtggatttccatcaccgaggccctagctttcttccactgttgt
ctgaaccccatcctctatgctttccttggagccaaatttaaaacctctgcccagcacgca
ctcacctctgtgagcagagggtccagcctcaagatcctctccaaaggaaagcgaggtgga
cattcatctgtttccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system