KEGG   Homo sapiens (human): 790Help
Entry
790               CDS       T01001                                 

Gene name
CAD
Definition
carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase (EC:2.1.3.2 3.5.2.3 6.3.5.5)
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hsa00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22-p21
AA seq 2225 aa AA seqDB search
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTVCNMENLDPLGIHTGESIVVAPSQTLNDREYQLLRQTAIKVTQHLG
IVGECNVQYALNPESEQYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRN
SVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKAL
RMVDENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRM
KRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAV
KQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQ
QLRKMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLP
NNMAMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQT
VGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAV
ASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFN
LQLIAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVG
VKVPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIG
SYKNKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSI
LEQLAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEAL
GQIGPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMV
CAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLN
ETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVI
DCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIF
HLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVL
VPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASD
PGLPAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHS
LVGQHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSF
AAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRR
PVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVS
LRYVAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEA
CFGQFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLAT
VLGRF
NT seq 6678 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctagtgttggaggacgggtcggtcctgcggggccagccctttggggccgcc
gtgtcgactgccggggaagtggtgtttcaaaccggcatggtcggctaccccgaggccctc
actgatccctcctacaaggcacagatcttagtgctcacctatcctctgatcggcaactat
ggcatccccccagatgaaatggatgagttcggtctctgcaagtggtttgaatcctcgggc
atccacgtagcagcactggtagtgggagagtgctgtcctactcccagccactggagtgcc
acccgcaccctgcatgagtggctgcagcagcatggcatccctggcttgcaaggagtagac
actcgggagctgaccaagaagttgcgggaacaggggtctctgctggggaagctggtccag
aatggaacagaaccttcatccctgccattcttggaccccaatgcccgccccctggtacca
gaggtctccattaagactccacgggtattcaatacagggggtgcccctcggatccttgct
ttggactgtggcctcaagtataatcagatccgatgcctctgccagcgtggggctgaggtc
actgtggtaccctgggaccatgcactagacagccaagagtatgagggtctcttcttaagt
aatgggcctggtgaccctgcctcctatcccagtgtcgtatccacactgagccgtgtttta
tctgagcctaatccccgacctgtctttgggatctgcctgggacaccagctattggcctta
gccattggggccaagacttacaagatgagatatgggaaccgaggccataaccagccctgc
ttgttggtgggctctgggcgctgctttctgacatcccagaaccatgggtttgctgtggag
acagactcactgccagcagactgggctcctctcttcaccaacgccaatgatggttccaat
gaaggcattgtgcacaacagcttgcctttcttcagtgtccagtttcacccagagcaccaa
gctggcccttcagatatggaactgcttttcgatatctttctggaaactgtgaaagaggcc
acagctgggaaccctgggggccagacagttagagagcggctgactgagcgcctctgtccc
cctgggattcccactcccggctctggacttccaccaccacgaaaggttctgatcctgggc
tcagggggcctctccattggccaagctggagaatttgactactcgggctctcaggcaatt
aaggccctgaaggaggaaaacatccagacgttgctgatcaaccccaatattgccacagtg
cagacctcccaggggctggccgacaaggtctattttcttcccataacacctcattatgta
acccaggtgatacgtaatgaacgccccgatggtgtgttactgacttttgggggccagact
gctctgaactgtggtgtggagctgaccaaggccggggtgctggctcggtatggggtccgg
gtcctgggcacaccagtggagaccattgagctgaccgaggatcgacgggcctttgctgcc
agaatggcagagatcggagagcatgtggccccgagcgaggcagcaaattctcttgaacag
gcccaggcagccgctgaacggctggggtaccctgtgctagtgcgtgcagcctttgccctg
ggtggcctgggctctggctttgcctctaacagggaggagctctctgctctcgtggcccca
gcttttgcccataccagccaagtgctagtagacaagtctctgaagggatggaaggagatt
gagtacgaggtggtgagagacgcctatggcaactgtgtcacggtgtgtaacatggagaac
ttggacccactgggcatccacactggtgagtccatagtggtggcccctagccagacactg
aatgacagggagtatcagctcctgaggcagacagctatcaaggtgacccagcacctggga
attgttggggagtgcaatgtgcagtatgccttgaaccctgagtctgagcagtattacatc
attgaagtgaatgccaggctctctcgcagctctgccctggccagtaaggccacaggttat
ccactggcttatgtggcagccaagctagcattgggcatccctttgcctgagctcaggaac
tctgtgacagggggtacagcagcctttgaacccagcgtggattattgtgtggtgaagatt
cctcgatgggaccttagcaagttcctgcgagtcagcacaaagattgggagctgcatgaag
agcgttggtgaagtcatgggcattgggcgttcatttgaggaggccttccagaaggccctg
cgcatggtggatgagaactgtgtgggctttgatcacacagtgaaaccagtcagcgatatg
gagttggagactccaacagataagcggatttttgtggtggcagctgctttgtgggctggt
tattcagtggaccgcctgtatgagctcacacgcatcgaccgctggttcctgcaccgaatg
aagcgtatcatcgcacatgcccagctgctagaacaacaccgtggacagcctttgccgcca
gacctgctgcaacaggccaagtgtcttggcttctcagacaaacagattgcccttgcagtt
ctgagcacagagctggctgttcgcaagctgcgtcaggaactggggatctgtccagcagtg
aaacagattgacacagttgcagctgagtggccagcccagacaaattacctatacctaacg
tattggggcaccacccatgacctcacctttcgaacacctcatgtcctagtccttggctct
ggcgtctaccgtattggctctagcgttgaatttgactggtgtgctgtaggctgcatccag
cagctccgaaagatgggatataagaccatcatggtgaactataacccagagacagtcagc
accgactatgacatgtgtgatcgactctactttgatgagatctcttttgaggtggtgatg
gacatctatgagctcgagaaccctgaaggtgtgatcctatccatgggtggacagctgccc
aacaacatggccatggcgttgcatcggcagcagtgccgggtgctgggcacctcccctgaa
gccattgactcggctgagaaccgtttcaagttttcccggctccttgacaccattggtatc
agccagcctcagtggagggagctcagtgacctcgagtctgctcgccaattctgccagacc
gtggggtacccctgtgtggtgcgcccctcctatgtgctgagcggtgctgctatgaatgtg
gcctacacggatggagacctggagcgcttcctgagcagcgcagcagccgtctccaaagag
catcccgtggtcatctccaagttcatccaggaggctaaggagattgacgtggatgccgtg
gcctctgatggtgtggtggcagccatcgccatctctgagcatgtggagaatgcaggtgtg
cattcaggtgatgcgacgctggtgacccccccacaagatatcactgccaaaaccctggag
cggatcaaagccattgtgcatgctgtgggccaggagctacaggtcacaggacccttcaat
ctgcagctcattgccaaggatgaccagctgaaagttattgaatgcaacgtacgtgtctct
cgctccttccccttcgtttccaagacactgggtgtggacctagtagccttggccacgcgg
gtcatcatgggggaagaagtggaacctgtggggctaatgactggttctggagtcgtggga
gtaaaggtgcctcagttctccttctcccgcttggcgggtgctgacgtggtgttgggtgtg
gaaatgaccagtactggggaggtggccggctttggggagagccgctgtgaggcatacctc
aaggccatgctaagcactggctttaagatccccaagaagaatatcctgctgaccattggc
agctataagaacaaaagcgagctgctcccaactgtgcggctactggagagcctgggctac
agcctctatgccagtctcggcacagctgacttctacactgagcatggcgtcaaggtaaca
gctgtggactggcactttgaggaggctgtggatggtgagtgcccaccacagcggagcatc
ctggagcagctagctgagaaaaactttgagctggtgattaacctgtcaatgcgtggagct
gggggccggcgtctctcttcctttgtcaccaagggctaccgcacccgacgcttggccgct
gacttctccgtgcccctaatcatcgatatcaagtgcaccaaactctttgtggaggcccta
ggccagatcgggccagcccctcctttgaaggtgcatgttgactgtatgacctcccaaaag
cttgtgcgactgccgggattgattgatgtccatgtgcacctgcgggaaccaggtgggaca
cataaggaggactttgcttcaggcacagccgctgccctggctgggggtatcaccatggtg
tgtgccatgcctaatacccggccccccatcattgacgcccctgctctggccctggcccag
aagctggcagaggctggcgcccggtgcgactttgcgctattccttggggcctcgtctgaa
aatgcaggaaccttgggcaccgtggccgggtctgcagccgggctgaagctttacctcaat
gagaccttctctgagctgcggctggacagcgtggtccagtggatggagcatttcgagaca
tggccctcccacctccccattgtggctcacgcagagcagcaaaccgtggctgctgtcctc
atggtggctcagctcactcagcgctcagtgcacatatgtcacgtggcacggaaggaggag
atcctgctaattaaagctgcaaaggcacggggcttgccagtgacctgcgaggtggctccc
caccacctgttcctaagccatgatgacctggagcgcctggggcctgggaagggggaggtc
cggcctgagcttggctcccgccaggatgtggaagccctgtgggagaacatggctgtcatc
gactgctttgcctcagaccatgctccccataccttggaggagaagtgtgggtccaggccc
ccacctgggttcccagggttagagaccatgctgccactactcctgacggctgtaagcgag
ggccggctcagcctggacgacctgctgcagcgattgcaccacaatcctcggcgcatcttt
cacctgcccccgcaggaggacacctatgtggaggtggatctggagcatgagtggacaatt
cccagccacatgcccttctccaaggcccactggacaccttttgaagggcagaaagtgaag
ggcaccgtccgccgtgtggtcctgcgaggggaggttgcctatatcgatgggcaggttctg
gtacccccgggctatggacaggatgtacggaagtggccacagggggctgttcctcagctc
ccaccctcagcccctgccactagtgagatgaccacgacacctgaaagaccccgccgtggc
atcccagggcttcctgatggccgcttccatctgccgccccgaatccatcgagcctccgac
ccaggtttgccagctgaggagccaaaggagaagtcctctcggaaggtagccgagccagag
ctgatgggaacccctgatggcacctgctaccctccaccaccagtaccgagacaggcatct
ccccagaacctggggacccctggcttgctgcacccccagacctcacccctgctgcactca
ttagtgggccaacatatcctgtccgtccagcagttcaccaaggatcagatgtctcacctg
ttcaatgtggcacacacactgcgtatgatggtgcagaaggagcggagcctcgacatcctg
aaggggaaggtcatggcctccatgttctatgaagtgagcacacggaccagcagctccttt
gcagcagccatggcccggctgggaggtgctgtgctcagcttctcggaagccacatcgtcc
gtccagaagggcgaatccctggctgactccgtgcagaccatgagctgctatgccgacgtc
gtcgtgctccggcacccccagcctggagcagtggagctggccgccaagcactgccggagg
ccagtgatcaatgctggggatggggtcggagagcaccccacccaggccctgctggacatc
ttcaccatccgtgaggagctgggaactgtcaatggcatgacgatcacgatggtgggtgac
ctgaagcacggacgcacagtacattccctggcctgcctgctcacccagtatcgtgtcagc
ctgcgctacgtggcacctcccagcctgcgcatgccacccactgtgcgggccttcgtggcc
tcccgcggcaccaagcaggaggaattcgagagcattgaggaggcgctgcctgacactgat
gtgctctacatgactcgaatccagaaggaacgatttggctctacccaggagtacgaagct
tgctttggtcagttcatcctcactccccacatcatgacccgggccaagaagaagatggtg
gtgatgcacccgatgccccgtgtcaacgagataagcgtggaagtggactcggatccccgc
gcagcctacttccgccaggctgagaacggcatgtacatccgcatggctctgttagccacc
gtgctgggccgtttctag

DBGET integrated database retrieval system