KEGG   Homo sapiens (human): 790Help
Entry
790               CDS       T01001                                 

Gene name
CAD
Definition
(RefSeq) carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase (EC:2.1.3.2 3.5.2.3 6.3.5.5)
  KO
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    790 (CAD)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    790 (CAD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     790 (CAD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     790 (CAD)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     790 (CAD)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   790 (CAD)
 Metallo Peptidases
  Family M38: beta-aspartyl dipeptidase family
   790 (CAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p22-p21
AA seq 2162 aa AA seqDB search
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNY
GIPPDEMDEFGLCKWFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVD
TRELTKKLREQGSLLGKLVQNGTEPSSLPFLDPNARPLVPEVSIKTPRVFNTGGAPRILA
LDCGLKYNQIRCLCQRGAEVTVVPWDHALDSQEYEGLFLSNGPGDPASYPSVVSTLSRVL
SEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPCLLVGSGRCFLTSQNHGFAVE
TDSLPADWAPLFTNANDGSNEGIVHNSLPFFSVQFHPEHQAGPSDMELLFDIFLETVKEA
TAGNPGGQTVRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
KALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQVIRNERPDGVLLTFGGQT
ALNCGVELTKAGVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEI
EYEVVRDAYGNCVTYYIIEVNARLSRSSALASKATGYPLAYVAAKLALGIPLPELRNSVT
GGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVGEVMGIGRSFEEAFQKALRMV
DENCVGFDHTVKPVSDMELETPTDKRIFVVAAALWAGYSVDRLYELTRIDRWFLHRMKRI
IAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQI
DTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLR
KMGYKTIMVNYNPETVSTDYDMCDRLYFDEISFEVVMDIYELENPEGVILSMGGQLPNNM
AMALHRQQCRVLGTSPEAIDSAENRFKFSRLLDTIGISQPQWRELSDLESARQFCQTVGY
PCVVRPSYVLSGAAMNVAYTDGDLERFLSSAAAVSKEHPVVISKFIQEAKEIDVDAVASD
GVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIKAIVHAVGQELQVTGPFNLQL
IAKDDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLMTGSGVVGVKV
PQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYK
NKSELLPTVRLLESLGYSLYASLGTADFYTEHGVKVTAVDWHFEEAVDGECPPQRSILEQ
LAEKNFELVINLSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVEALGQI
GPAPPLKVHVDCMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAM
PNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETF
SELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILL
IKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCF
ASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLP
PQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPP
GYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPDGRFHLPPRIHRASDPGL
PAEEPKEKSSRKVAEPELMGTPDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHSLVG
QHILSVQQFTKDQMSHLFNVAHTLRMMVQKERSLDILKGKVMASMFYEVSTRTSSSFAAA
MARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVLRHPQPGAVELAAKHCRRPVI
NAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACLLTQYRVSLRY
VAPPSLRMPPTVRAFVASRGTKQEEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFG
QFILTPHIMTRAKKKMVVMHPMPRVNEISVEVDSDPRAAYFRQAENGMYIRMALLATVLG
RF
NT seq 6489 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctagtgttggaggacgggtcggtcctgcggggccagccctttggggccgcc
gtgtcgactgccggggaagtggtgtttcaaaccggcatggtcggctaccccgaggccctc
actgatccctcctacaaggcacagatcttagtgctcacctatcctctgatcggcaactat
ggcatccccccagatgaaatggatgagttcggtctctgcaagtggtttgaatcctcgggc
atccacgtagcagcactggtagtgggagagtgctgtcctactcccagccactggagtgcc
acccgcaccctgcatgagtggctgcagcagcatggcatccctggcttgcaaggagtagac
actcgggagctgaccaagaagttgcgggaacaggggtctctgctggggaagctggtccag
aatggaacagaaccttcatccctgccattcttggaccccaatgcccgccccctggtacca
gaggtctccattaagactccacgggtattcaatacagggggtgcccctcggatccttgct
ttggactgtggcctcaagtataatcagatccgatgcctctgccagcgtggggctgaggtc
actgtggtaccctgggaccatgcactagacagccaagagtatgagggtctcttcttaagt
aatgggcctggtgaccctgcctcctatcccagtgtcgtatccacactgagccgtgtttta
tctgagcctaatccccgacctgtctttgggatctgcctgggacaccagctattggcctta
gccattggggccaagacttacaagatgagatatgggaaccgaggccataaccagccctgc
ttgttggtgggctctgggcgctgctttctgacatcccagaaccatgggtttgctgtggag
acagactcactgccagcagactgggctcctctcttcaccaacgccaatgatggttccaat
gaaggcattgtgcacaacagcttgcctttcttcagtgtccagtttcacccagagcaccaa
gctggcccttcagatatggaactgcttttcgatatctttctggaaactgtgaaagaggcc
acagctgggaaccctgggggccagacagttagagagcggctgactgagcgcctctgtccc
cctgggattcccactcccggctctggacttccaccaccacgaaaggttctgatcctgggc
tcagggggcctctccattggccaagctggagaatttgactactcgggctctcaggcaatt
aaggccctgaaggaggaaaacatccagacgttgctgatcaaccccaatattgccacagtg
cagacctcccaggggctggccgacaaggtctattttcttcccataacacctcattatgta
acccaggtgatacgtaatgaacgccccgatggtgtgttactgacttttgggggccagact
gctctgaactgtggtgtggagctgaccaaggccggggtgctggctcggtatggggtccgg
gtcctgggcacaccagtggagaccattgagctgaccgaggatcgacgggcctttgctgcc
agaatggcagagatcggagagcatgtggccccgagcgaggcagcaaattctcttgaacag
gcccaggcagccgctgaacggctggggtaccctgtgctagtgcgtgcagcctttgccctg
ggtggcctgggctctggctttgcctctaacagggaggagctctctgctctcgtggcccca
gcttttgcccataccagccaagtgctagtagacaagtctctgaagggatggaaggagatt
gagtacgaggtggtgagagacgcctatggcaactgtgtcacgtattacatcattgaagtg
aatgccaggctctctcgcagctctgccctggccagtaaggccacaggttatccactggct
tatgtggcagccaagctagcattgggcatccctttgcctgagctcaggaactctgtgaca
gggggtacagcagcctttgaacccagcgtggattattgtgtggtgaagattcctcgatgg
gaccttagcaagttcctgcgagtcagcacaaagattgggagctgcatgaagagcgttggt
gaagtcatgggcattgggcgttcatttgaggaggccttccagaaggccctgcgcatggtg
gatgagaactgtgtgggctttgatcacacagtgaaaccagtcagcgatatggagttggag
actccaacagataagcggatttttgtggtggcagctgctttgtgggctggttattcagtg
gaccgcctgtatgagctcacacgcatcgaccgctggttcctgcaccgaatgaagcgtatc
atcgcacatgcccagctgctagaacaacaccgtggacagcctttgccgccagacctgctg
caacaggccaagtgtcttggcttctcagacaaacagattgcccttgcagttctgagcaca
gagctggctgttcgcaagctgcgtcaggaactggggatctgtccagcagtgaaacagatt
gacacagttgcagctgagtggccagcccagacaaattacctatacctaacgtattggggc
accacccatgacctcacctttcgaacacctcatgtcctagtccttggctctggcgtctac
cgtattggctctagcgttgaatttgactggtgtgctgtaggctgcatccagcagctccga
aagatgggatataagaccatcatggtgaactataacccagagacagtcagcaccgactat
gacatgtgtgatcgactctactttgatgagatctcttttgaggtggtgatggacatctat
gagctcgagaaccctgaaggtgtgatcctatccatgggtggacagctgcccaacaacatg
gccatggcgttgcatcggcagcagtgccgggtgctgggcacctcccctgaagccattgac
tcggctgagaaccgtttcaagttttcccggctccttgacaccattggtatcagccagcct
cagtggagggagctcagtgacctcgagtctgctcgccaattctgccagaccgtggggtac
ccctgtgtggtgcgcccctcctatgtgctgagcggtgctgctatgaatgtggcctacacg
gatggagacctggagcgcttcctgagcagcgcagcagccgtctccaaagagcatcccgtg
gtcatctccaagttcatccaggaggctaaggagattgacgtggatgccgtggcctctgat
ggtgtggtggcagccatcgccatctctgagcatgtggagaatgcaggtgtgcattcaggt
gatgcgacgctggtgacccccccacaagatatcactgccaaaaccctggagcggatcaaa
gccattgtgcatgctgtgggccaggagctacaggtcacaggacccttcaatctgcagctc
attgccaaggatgaccagctgaaagttattgaatgcaacgtacgtgtctctcgctccttc
cccttcgtttccaagacactgggtgtggacctagtagccttggccacgcgggtcatcatg
ggggaagaagtggaacctgtggggctaatgactggttctggagtcgtgggagtaaaggtg
cctcagttctccttctcccgcttggcgggtgctgacgtggtgttgggtgtggaaatgacc
agtactggggaggtggccggctttggggagagccgctgtgaggcatacctcaaggccatg
ctaagcactggctttaagatccccaagaagaatatcctgctgaccattggcagctataag
aacaaaagcgagctgctcccaactgtgcggctactggagagcctgggctacagcctctat
gccagtctcggcacagctgacttctacactgagcatggcgtcaaggtaacagctgtggac
tggcactttgaggaggctgtggatggtgagtgcccaccacagcggagcatcctggagcag
ctagctgagaaaaactttgagctggtgattaacctgtcaatgcgtggagctgggggccgg
cgtctctcttcctttgtcaccaagggctaccgcacccgacgcttggccgctgacttctcc
gtgcccctaatcatcgatatcaagtgcaccaaactctttgtggaggccctaggccagatc
gggccagcccctcctttgaaggtgcatgttgactgtatgacctcccaaaagcttgtgcga
ctgccgggattgattgatgtccatgtgcacctgcgggaaccaggtgggacacataaggag
gactttgcttcaggcacagccgctgccctggctgggggtatcaccatggtgtgtgccatg
cctaatacccggccccccatcattgacgcccctgctctggccctggcccagaagctggca
gaggctggcgcccggtgcgactttgcgctattccttggggcctcgtctgaaaatgcagga
accttgggcaccgtggccgggtctgcagccgggctgaagctttacctcaatgagaccttc
tctgagctgcggctggacagcgtggtccagtggatggagcatttcgagacatggccctcc
cacctccccattgtggctcacgcagagcagcaaaccgtggctgctgtcctcatggtggct
cagctcactcagcgctcagtgcacatatgtcacgtggcacggaaggaggagatcctgcta
attaaagctgcaaaggcacggggcttgccagtgacctgcgaggtggctccccaccacctg
ttcctaagccatgatgacctggagcgcctggggcctgggaagggggaggtccggcctgag
cttggctcccgccaggatgtggaagccctgtgggagaacatggctgtcatcgactgcttt
gcctcagaccatgctccccataccttggaggagaagtgtgggtccaggcccccacctggg
ttcccagggttagagaccatgctgccactactcctgacggctgtaagcgagggccggctc
agcctggacgacctgctgcagcgattgcaccacaatcctcggcgcatctttcacctgccc
ccgcaggaggacacctatgtggaggtggatctggagcatgagtggacaattcccagccac
atgcccttctccaaggcccactggacaccttttgaagggcagaaagtgaagggcaccgtc
cgccgtgtggtcctgcgaggggaggttgcctatatcgatgggcaggttctggtacccccg
ggctatggacaggatgtacggaagtggccacagggggctgttcctcagctcccaccctca
gcccctgccactagtgagatgaccacgacacctgaaagaccccgccgtggcatcccaggg
cttcctgatggccgcttccatctgccgccccgaatccatcgagcctccgacccaggtttg
ccagctgaggagccaaaggagaagtcctctcggaaggtagccgagccagagctgatggga
acccctgatggcacctgctaccctccaccaccagtaccgagacaggcatctccccagaac
ctggggacccctggcttgctgcacccccagacctcacccctgctgcactcattagtgggc
caacatatcctgtccgtccagcagttcaccaaggatcagatgtctcacctgttcaatgtg
gcacacacactgcgtatgatggtgcagaaggagcggagcctcgacatcctgaaggggaag
gtcatggcctccatgttctatgaagtgagcacacggaccagcagctcctttgcagcagcc
atggcccggctgggaggtgctgtgctcagcttctcggaagccacatcgtccgtccagaag
ggcgaatccctggctgactccgtgcagaccatgagctgctatgccgacgtcgtcgtgctc
cggcacccccagcctggagcagtggagctggccgccaagcactgccggaggccagtgatc
aatgctggggatggggtcggagagcaccccacccaggccctgctggacatcttcaccatc
cgtgaggagctgggaactgtcaatggcatgacgatcacgatggtgggtgacctgaagcac
ggacgcacagtacattccctggcctgcctgctcacccagtatcgtgtcagcctgcgctac
gtggcacctcccagcctgcgcatgccacccactgtgcgggccttcgtggcctcccgcggc
accaagcaggaggaattcgagagcattgaggaggcgctgcctgacactgatgtgctctac
atgactcgaatccagaaggaacgatttggctctacccaggagtacgaagcttgctttggt
cagttcatcctcactccccacatcatgacccgggccaagaagaagatggtggtgatgcac
ccgatgccccgtgtcaacgagataagcgtggaagtggactcggatccccgcgcagcctac
ttccgccaggctgagaacggcatgtacatccgcatggctctgttagccaccgtgctgggc
cgtttctag

DBGET integrated database retrieval system