KEGG   Homo sapiens (human): 7941Help
Entry
7941              CDS       T01001                                 

Gene name
PLA2G7, LDL-PLA2, LP-PLA2, PAFAD, PAFAH
Definition
(RefSeq) phospholipase A2 group VII
  KO
K01062  
platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
Ether lipid metabolism
Metabolic pathways
Drug target
Darapladib: 
Goxalapladib: 
Rilapladib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00565 Ether lipid metabolism
    7941 (PLA2G7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     7941 (PLA2G7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13093(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6p12.3
AA seq 441 aa AA seqDB search
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggtgccacccaaattgcatgtgcttttctgcctctgcggctgcctggctgtggtttat
ccttttgactggcaatacataaatcctgttgcccatatgaaatcatcagcatgggtcaac
aaaatacaagtactgatggctgctgcaagctttggccaaactaaaatcccccggggaaat
gggccttattccgttggttgtacagacttaatgtttgatcacactaataagggcaccttc
ttgcgtttatattatccatcccaagataatgatcgccttgacaccctttggatcccaaat
aaagaatatttttggggtcttagcaaatttcttggaacacactggcttatgggcaacatt
ttgaggttactctttggttcaatgacaactcctgcaaactggaattcccctctgaggcct
ggtgaaaaatatccacttgttgttttttctcatggtcttggggcattcaggacactttat
tctgctattggcattgacctggcatctcatgggtttatagttgctgctgtagaacacaga
gatagatctgcatctgcaacttactatttcaaggaccaatctgctgcagaaataggggac
aagtcttggctctaccttagaaccctgaaacaagaggaggagacacatatacgaaatgag
caggtacggcaaagagcaaaagaatgttcccaagctctcagtctgattcttgacattgat
catggaaagccagtgaagaatgcattagatttaaagtttgatatggaacaactgaaggac
tctattgatagggaaaaaatagcagtaattggacattcttttggtggagcaacggttatt
cagactcttagtgaagatcagagattcagatgtggtattgccctggatgcatggatgttt
ccactgggtgatgaagtatattccagaattcctcagcccctcttttttatcaactctgaa
tatttccaatatcctgctaatatcataaaaatgaaaaaatgctactcacctgataaagaa
agaaagatgattacaatcaggggttcagtccaccagaattttgctgacttcacttttgca
actggcaaaataattggacacatgctcaaattaaagggagacatagattcaaatgtagct
attgatcttagcaacaaagcttcattagcattcttacaaaagcatttaggacttcataaa
gattttgatcagtgggactgcttgattgaaggagatgatgagaatcttattccagggacc
aacattaacacaaccaatcaacacatcatgttacagaactcttcaggaatagagaaatac
aattag

DBGET integrated database retrieval system