KEGG   Homo sapiens (human): 79501Help
Entry
79501             CDS       T01001                                 

Gene name
OR4F5
Definition
(RefSeq) olfactory receptor family 4 subfamily F member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    79501 (OR4F5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    79501 (OR4F5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79501
NCBI-ProteinID: NP_001005484
HGNC: 14825
Ensembl: ENSG00000186092
Vega: OTTHUMG00000001094
Pharos: Q8NH21(Tdark)
UniProt: Q8NH21
Position
1p36.33
AA seq 305 aa AA seqDB search
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS
LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC
KPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKL
ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV
LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH
SSVKF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgaattcatttttctgggtctctctgattctcaggaactccagaccttccta
tttatgttgttttttgtattctatggaggaatcgtgtttggaaaccttcttattgtcata
acagtggtatctgactcccaccttcactctcccatgtacttcctgctagccaacctctca
ctcattgatctgtctctgtcttcagtcacagcccccaagatgattactgactttttcagc
cagcgcaaagtcatctctttcaagggctgccttgttcagatatttctccttcacttcttt
ggtgggagtgagatggtgatcctcatagccatgggctttgacagatatatagcaatatgc
aagcccctacactacactacaattatgtgtggcaacgcatgtgtcggcattatggctgtc
acatggggaattggctttctccattcggtgagccagttggcgtttgccgtgcacttactc
ttctgtggtcccaatgaggtcgatagtttttattgtgaccttcctagggtaatcaaactt
gcctgtacagatacctacaggctagatattatggtcattgctaacagtggtgtgctcact
gtgtgttcttttgttcttctaatcatctcatacactatcatcctaatgaccatccagcat
cgccctttagataagtcgtccaaagctctgtccactttgactgctcacattacagtagtt
cttttgttctttggaccatgtgtctttatttatgcctggccattccccatcaagtcatta
gataaattccttgctgtattttattctgtgatcacccctctcttgaacccaattatatac
acactgaggaacaaagacatgaagacggcaataagacagctgagaaaatgggatgcacat
tctagtgtaaagttttag

DBGET integrated database retrieval system