KEGG   Homo sapiens (human): 79784Help
Entry
79784             CDS       T01001                                 

Gene name
MYH14, DFNA4, DFNA4A, FP17425, MHC16, MYH17, NMHC_II-C, NMHC-II-C, PNMHH, myosin
Definition
(RefSeq) myosin heavy chain 14
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Regulation of actin cytoskeleton
Salmonella infection
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    79784 (MYH14)
  Cell motility
   04810 Regulation of actin cytoskeleton
    79784 (MYH14)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    79784 (MYH14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     79784 (MYH14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   79784 (MYH14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q7Z406(Tbio)
UniProt: 
Position
19q13.33
AA seq 1995 aa AA seqDB search
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPS
ELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEAS
VLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEG
AYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECS
FHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHE
EIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRI
KVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDL
IERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYA
GKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGG
RPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRV
GQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQRNC
AAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQGRVA
QLEEERARLAEQLRAEAELCAEAEETRGRLAARKQELELVVSELEARVGEEEECSRQMQT
EKKRLQQHIQELEAHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERKL
LEDRLAEFSSQAAEEEEKVKSLNKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGE
SSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEA
QEDLESERVARTKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTL
EEETRIHEAAVQELRQRHGQALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSL
QTARQEGEQRRRRLELQLQEVQGRAGDGERARAEAAEKLQRAQAELENVSGALNEAESKT
IRLSKELSSTEAQLHDAQELLQEETRAKLALGSRVRAMEAEAAGLREQLEEEAAARERAG
RELQTAQAQLSEWRRRQEEEAGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRR
RLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRAVEERERAEAEGREREA
RALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKSVHELERACRVAEQAAND
LRAQVTELEDELTAAEDAKLRLEVTVQALKTQHERDLQGRDEAGEERRRQLAKQLRDAEV
ERDEERKQRTLAVAARKKLEGELEELKAQMASAGQGKEEAVKQLRKMQAQMKELWREVEE
TRTSREEIFSQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMADEVANGNLS
KAAILEEKRQLEGRLGQLEEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKA
ESGRQQLERQIQELRGRLGEEDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKL
VRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGRRRL
QRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAQPGS
GPSPEPEGSPPAHPQ
NT seq 5988 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtgaccatgtcggtgcccgggcggaaggcgccccccaggccgggcccagtg
cccgaggcggcccagccgttcctgttcacgccccgcgggcccagcgcgggtggcgggcct
ggctcgggcacctccccgcaggtggagtggacggcccggcgtctcgtgtgggtgccttcg
gagcttcacgggttcgaggcggcggcgctgcgggacgaaggcgaggaggaggcggaggtg
gagctggcggagagcgggaggcggctgcgactgccgcgggaccagatccagcgcatgaac
ccgcccaagttcagcaaggccgaggacatggccgagctgacctgcctcaacgaggcctcg
gtcctgcacaacctccgggagcggtactactccggcctcatctacacgtactccggcctt
ttctgtgtggtcatcaacccgtacaagcagcttcccatctacacagaagccattgtggag
atgtaccggggcaagaagcgccacgaggtgccaccccacgtgtacgcagtgaccgagggg
gcctatcggagcatgctgcaggatcgtgaggaccagtccattctctgcactggagagtct
ggagctgggaagacggaaaacaccaagaaggtcatccagtacctcgcccacgtggcgtcg
tctccaaagggcaggaaggagccgggtgtccccggtgagctggagcggcagctgcttcag
gccaaccccatcctagaggcctttggcaatgccaagacagtgaagaatgacaactcctcc
cgattcggcaaattcatccgcatcaactttgatgttgccgggtacatcgtgggcgccaac
attgagacctacctgctggagaagtcgcgggccatccgccaggccaaggacgagtgcagc
ttccacatcttctaccagctgctggggggcgctggagagcagctcaaagccgacctcctc
ctcgagccctgctcccactaccggttcctgaccaacgggccgtcatcctctcccggccag
gagcgggaactcttccaggagacgctggagtcgctgcgggtcctgggattcagccacgag
gaaatcatctccatgctgcggatggtctcagcagttctccagtttggcaacattgccttg
aagagagaacggaacaccgatcaagccaccatgcctgacaacacagctgcacagaagctc
tgccgcctcttgggactgggggtgacggatttctcccgagccttgctcacccctcgcatc
aaagttggccgagactatgtgcagaaagcccagactaaggaacaggctgacttcgcgctg
gaggccctggccaaggccacctacgagcgcctcttccgctggctggttctgcgcctcaac
cgggccttggaccgcagcccccgccaaggcgcctccttcctgggcatcctggacatcgcg
ggctttgagatcttccagctgaactccttcgagcagctctgcatcaactacaccaacgag
aagctgcagcagctcttcaaccacaccatgttcgtgctggagcaggaggagtaccagcgt
gagggcatcccctggaccttcctcgactttggcctcgacctgcagccctgcatcgacctc
atcgagcggccggccaacccccctggactcctggccctgctggatgaggagtgctggttc
ccgaaggccacagacaagtcgtttgtggagaaggtagcccaggagcagggcggccacccc
aagttccagcggccgaggcacctgcgggatcaggccgacttcagtgttctccactacgcg
ggcaaggtcgactacaaggccaacgagtggctgatgaaaaacatggaccctctgaatgac
aacgtcgcagccttgctccaccagagcacagaccggctgacggcagagatctggaaagac
gtggagggcatcgtggggctggaacaggtgagcagcctgggcgacggcccaccaggtggc
cgcccccgtcggggtatgttccggacagtgggacagctctacaaggagtccctgagccgc
ctcatggccacactcagcaacaccaaccccagttttgtccgctgcattgtccccaaccac
gagaagagggccgggaagctggagccacggctggtgctggaccagcttcgctgcaacggg
gtcctggagggcatccgcatctgtcgccagggcttccccaaccgcatcctcttccaggag
ttccggcagcgatacgagatcctgacacccaatgccatccccaagggcttcatggatggg
aagcaggcctgtgaaaagatgatccaggcgctggaactggaccccaacctctaccgcgtg
ggacagagcaagatcttcttccgggctggggtcctggcccagctggaagaggagcgagac
ctgaaggtcaccgacatcatcgtctccttccaggcagctgcccggggatacctggctcgc
agggccttccagaagcgccagcagcagcagagcgccctgagggtgatgcagcggaactgc
gcggcctacctcaagctgagacactggcagtggtggcggctgtttaccaaggtgaagcca
ctgctgcaggtgacgcggcaggatgaggtgctgcaggcacgggcccaggagctgcagaaa
gtgcaggagctacagcagcagagcgcccgcgaagttggggagctccagggccgagtggca
cagctggaagaggagcgcgcccgcctggcagagcaattgcgagcagaggcagaactgtgt
gcagaggccgaggagacgcgggggaggctggcagcccgcaagcaggagctggagctggtg
gtgtcagagctggaggctcgcgtgggcgaggaggaggagtgcagccgtcaaatgcaaacc
gagaagaagaggctgcagcagcacatacaggagctagaggcccaccttgaggctgaggag
ggtgcgcggcagaagctgcagctggagaaggtgacgacagaggcaaaaatgaagaaattt
gaagaggacctgctgctcctggaagaccagaattccaagctgagcaaggagcggaagctg
ctggaagatcgtctggccgagttctcatcccaggcagctgaggaggaggagaaggtcaag
agcctcaataagctacggctcaaatatgaggccacaatcgcagacatggaggaccgccta
cggaaggaggagaagggtcgccaggagctggagaagctgaagcggaggctggatggggag
agctcagagctgcaggagcagatggtggagcagcaacagcgggcagaggagctgcgggcc
cagctgggccggaaggaggaggagctgcaggctgccctggccagggcagaagacgagggt
ggggcccgggcccagctgctgaaatccctgcgggaggctcaagcagccctggccgaggcc
caggaggacctggagtctgagcgtgtggccaggaccaaggcggagaagcagcgccgggac
ctgggcgaggagctggaggcgctgcggggcgagctggaggacacgctggactccaccaac
gcacagcaggagctccggtccaagagggaacaggaggtgacggagctgaagaagactctg
gaggaggagactcgcatccacgaggcggcagtgcaggagctgaggcagcgccacggccag
gccctgggggagctggcggagcagctggagcaggcccggaggggcaaaggtgcatgggag
aagacccggctggccctggaggccgaggtgtccgagctgcgggcagaactgagcagcctg
cagactgcacgtcaggagggtgagcagcggaggcgccgcctggagttacagctgcaggag
gtgcagggccgggctggtgatggggagagggcacgagcggaggctgctgagaagctgcag
cgagcccaggctgaactggagaatgtgtctggggcgctgaacgaggctgagtccaaaacc
atccgtcttagcaaggagctgagcagcacagaagcccagctgcacgatgcccaggagctg
ctgcaggaggagaccagggcgaaattggccttggggtcccgggtgcgagccatggaggct
gaggcagccgggctgcgtgagcagctggaggaggaggcagctgccagggaacgggcgggc
cgtgaactgcagactgcccaggcccagctttccgagtggcggcggcgccaggaggaggag
gcaggggcactggaggcaggggaggaggcacggcgccgggcagcccgggaggccgaggcc
ctgacccagcgcctggcagaaaagacagagaccgtggatcggctggagcggggccgccgc
cggctgcagcaggagctggacgacgccaccatggacctggagcagcagcggcagcttgtg
agcaccctggagaagaagcagcgcaagtttgaccagcttctggcagaggagaaggcagct
gtacttcgggcagtggaggaacgtgagcgggccgaggcagagggccgggagcgtgaggct
cgggccctgtcactgacacgggcactggaggaggagcaggaggcacgtgaggagctggag
cggcagaaccgggccctgcgggctgagctggaggcactgctgagcagcaaggatgacgtc
ggcaagagcgtgcatgagctggaacgagcctgccgggtagcagaacaggcagccaatgat
ctgcgagcacaggtgacagaactggaggatgagctgacagcggccgaggatgccaagctg
cgtctggaggtgactgtgcaggctctcaagactcagcatgagcgtgacctgcagggccgt
gatgaggctggtgaagagaggcggaggcagctggccaagcagctgagagatgcagaggtg
gagcgggatgaggagcggaagcagcgcactctggccgtggctgcccgcaagaagctggag
ggagagctggaggagctgaaggctcagatggcctctgccggccagggcaaggaggaggcg
gtgaagcagcttcgcaagatgcaggcccagatgaaggagctatggcgggaggtggaggag
acacgcacctcccgggaggagatcttctcccagaatcgggaaagtgaaaagcgcctcaag
ggcctggaggctgaggtgctgcggctgcaggaggaactggccgcctcggaccgtgctcgg
cggcaggcccagcaggaccgggatgagatggcagatgaggtggccaatggtaaccttagc
aaggcagccattctggaggagaagcgtcagctggaggggcgcctggggcagttggaggaa
gagctggaggaggagcagagcaactcggagctgctcaatgaccgctaccgcaagctgctc
ctgcaggtagagtcactgaccacagagctgtcagctgagcgcagtttctcagccaaggca
gagagcgggcggcagcagctggaacggcagatccaggagctacggggacgcctgggtgag
gaggatgctggggcccgtgcccgccacaagatgaccattgctgcccttgagtctaagttg
gcccaggctgaggagcagctagagcaagagaccagagagcgcatcctctctggaaagctg
gtgcgcagagctgagaagcggcttaaagaggtggtgctccaggtggaggaggagcggagg
gtggctgaccagctccgggaccagctggagaagggaaaccttcgagtcaagcagctgaag
cggcagctggaggaggccgaggaggaggcatcccgggctcaggccggccgccggaggctg
cagcgtgagctggaagatgtcacagagtcggccgagtccatgaaccgtgaagtgaccaca
ctgaggaaccggcttcgacgcggccccctcaccttcaccacccgcacggtgcgccaggtc
ttccgactagaggagggcgtggcatccgacgaggaggcagaggaagcacagcctgggtct
gggccatccccggagcctgaggggtccccaccagcccacccccagtga

DBGET integrated database retrieval system