KEGG   Homo sapiens (human): 79784Help
Entry
79784             CDS       T01001                                 

Gene name
MYH14, DFNA4, DFNA4A, FP17425, MHC16, MYH17, NMHC_II-C, NMHC-II-C, PNMHH, myosin
Definition
(RefSeq) myosin, heavy chain 14, non-muscle (EC:3.6.4.1)
  KO
K10352  
myosin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Regulation of actin cytoskeleton
Salmonella infection
Disease
H00604  
Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    79784 (MYH14)
  Cellular commiunity
   04530 Tight junction
    79784 (MYH14)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    79784 (MYH14)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     79784 (MYH14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   79784 (MYH14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 1995 aa AA seqDB search
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPS
ELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEAS
VLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEG
AYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECS
FHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHE
EIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRI
KVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDL
IERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYA
GKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGG
RPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRV
GQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQRNC
AAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQGRVA
QLEEERARLAEQLRAEAELCAEAEETRGRLAARKQELELVVSELEARVGEEEECSRQMQT
EKKRLQQHIQELEAHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERKL
LEDRLAEFSSQAAEEEEKVKSLNKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGE
SSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEA
QEDLESERVARTKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTL
EEETRIHEAAVQELRQRHGQALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSL
QTARQEGEQRRRRLELQLQEVQGRAGDGERARAEAAEKLQRAQAELENVSGALNEAESKT
IRLSKELSSTEAQLHDAQELLQEETRAKLALGSRVRAMEAEAAGLREQLEEEAAARERAG
RELQTAQAQLSEWRRRQEEEAGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRR
RLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRAVEERERAEAEGREREA
RALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKSVHELERACRVAEQAAND
LRAQVTELEDELTAAEDAKLRLEVTVQALKTQHERDLQGRDEAGEERRRQLAKQLRDAEV
ERDEERKQRTLAVAARKKLEGELEELKAQMASAGQGKEEAVKQLRKMQAQMKELWREVEE
TRTSREEIFSQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMADEVANGNLS
KAAILEEKRQLEGRLGQLEEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKA
ESGRQQLERQIQELRGRLGEEDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKL
VRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGRRRL
QRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAQPGS
GPSPEPEGSPPAHPQ
NT seq 5988 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgtgaccatgtcggtgcccgggcggaaggcgccccccaggccgggcccagtg
cccgaggcggcccagccgttcctgttcacgccccgcgggcccagcgcgggtggcgggcct
ggctcgggcacctccccgcaggtggagtggacggcccggcgtctcgtgtgggtgccttcg
gagcttcacgggttcgaggcggcggcgctgcgggacgaaggcgaggaggaggcggaggtg
gagctggcggagagcgggaggcggctgcgactgccgcgggaccagatccagcgcatgaac
ccgcccaagttcagcaaggccgaggacatggccgagctgacctgcctcaacgaggcctcg
gtcctgcacaacctccgggagcggtactactccggcctcatctacacgtactccggcctt
ttctgtgtggtcatcaacccgtacaagcagcttcccatctacacagaagccattgtggag
atgtaccggggcaagaagcgccacgaggtgccaccccacgtgtacgcagtgaccgagggg
gcctatcggagcatgctgcaggatcgtgaggaccagtccattctctgcactggagagtct
ggagctgggaagacggaaaacaccaagaaggtcatccagtacctcgcccacgtggcgtcg
tctccaaagggcaggaaggagccgggtgtccccggtgagctggagcggcagctgcttcag
gccaaccccatcctagaggcctttggcaatgccaagacagtgaagaatgacaactcctcc
cgattcggcaaattcatccgcatcaactttgatgttgccgggtacatcgtgggcgccaac
attgagacctacctgctggagaagtcgcgggccatccgccaggccaaggacgagtgcagc
ttccacatcttctaccagctgctggggggcgctggagagcagctcaaagccgacctcctc
ctcgagccctgctcccactaccggttcctgaccaacgggccgtcatcctctcccggccag
gagcgggaactcttccaggagacgctggagtcgctgcgggtcctgggattcagccacgag
gaaatcatctccatgctgcggatggtctcagcagttctccagtttggcaacattgccttg
aagagagaacggaacaccgatcaagccaccatgcctgacaacacagctgcacagaagctc
tgccgcctcttgggactgggggtgacggatttctcccgagccttgctcacccctcgcatc
aaagttggccgagactatgtgcagaaagcccagactaaggaacaggctgacttcgcgctg
gaggccctggccaaggccacctacgagcgcctcttccgctggctggttctgcgcctcaac
cgggccttggaccgcagcccccgccaaggcgcctccttcctgggcatcctggacatcgcg
ggctttgagatcttccagctgaactccttcgagcagctctgcatcaactacaccaacgag
aagctgcagcagctcttcaaccacaccatgttcgtgctggagcaggaggagtaccagcgt
gagggcatcccctggaccttcctcgactttggcctcgacctgcagccctgcatcgacctc
atcgagcggccggccaacccccctggactcctggccctgctggatgaggagtgctggttc
ccgaaggccacagacaagtcgtttgtggagaaggtagcccaggagcagggcggccacccc
aagttccagcggccgaggcacctgcgggatcaggccgacttcagtgttctccactacgcg
ggcaaggtcgactacaaggccaacgagtggctgatgaaaaacatggaccctctgaatgac
aacgtcgcagccttgctccaccagagcacagaccggctgacggcagagatctggaaagac
gtggagggcatcgtggggctggaacaggtgagcagcctgggcgacggcccaccaggtggc
cgcccccgtcggggtatgttccggacagtgggacagctctacaaggagtccctgagccgc
ctcatggccacactcagcaacaccaaccccagttttgtccgctgcattgtccccaaccac
gagaagagggccgggaagctggagccacggctggtgctggaccagcttcgctgcaacggg
gtcctggagggcatccgcatctgtcgccagggcttccccaaccgcatcctcttccaggag
ttccggcagcgatacgagatcctgacacccaatgccatccccaagggcttcatggatggg
aagcaggcctgtgaaaagatgatccaggcgctggaactggaccccaacctctaccgcgtg
ggacagagcaagatcttcttccgggctggggtcctggcccagctggaagaggagcgagac
ctgaaggtcaccgacatcatcgtctccttccaggcagctgcccggggatacctggctcgc
agggccttccagaagcgccagcagcagcagagcgccctgagggtgatgcagcggaactgc
gcggcctacctcaagctgagacactggcagtggtggcggctgtttaccaaggtgaagcca
ctgctgcaggtgacgcggcaggatgaggtgctgcaggcacgggcccaggagctgcagaaa
gtgcaggagctacagcagcagagcgcccgcgaagttggggagctccagggccgagtggca
cagctggaagaggagcgcgcccgcctggcagagcaattgcgagcagaggcagaactgtgt
gcagaggccgaggagacgcgggggaggctggcagcccgcaagcaggagctggagctggtg
gtgtcagagctggaggctcgcgtgggcgaggaggaggagtgcagccgtcaaatgcaaacc
gagaagaagaggctgcagcagcacatacaggagctagaggcccaccttgaggctgaggag
ggtgcgcggcagaagctgcagctggagaaggtgacgacagaggcaaaaatgaagaaattt
gaagaggacctgctgctcctggaagaccagaattccaagctgagcaaggagcggaagctg
ctggaagatcgtctggccgagttctcatcccaggcagctgaggaggaggagaaggtcaag
agcctcaataagctacggctcaaatatgaggccacaatcgcagacatggaggaccgccta
cggaaggaggagaagggtcgccaggagctggagaagctgaagcggaggctggatggggag
agctcagagctgcaggagcagatggtggagcagcaacagcgggcagaggagctgcgggcc
cagctgggccggaaggaggaggagctgcaggctgccctggccagggcagaagacgagggt
ggggcccgggcccagctgctgaaatccctgcgggaggctcaagcagccctggccgaggcc
caggaggacctggagtctgagcgtgtggccaggaccaaggcggagaagcagcgccgggac
ctgggcgaggagctggaggcgctgcggggcgagctggaggacacgctggactccaccaac
gcacagcaggagctccggtccaagagggaacaggaggtgacggagctgaagaagactctg
gaggaggagactcgcatccacgaggcggcagtgcaggagctgaggcagcgccacggccag
gccctgggggagctggcggagcagctggagcaggcccggaggggcaaaggtgcatgggag
aagacccggctggccctggaggccgaggtgtccgagctgcgggcagaactgagcagcctg
cagactgcacgtcaggagggtgagcagcggaggcgccgcctggagttacagctgcaggag
gtgcagggccgggctggtgatggggagagggcacgagcggaggctgctgagaagctgcag
cgagcccaggctgaactggagaatgtgtctggggcgctgaacgaggctgagtccaaaacc
atccgtcttagcaaggagctgagcagcacagaagcccagctgcacgatgcccaggagctg
ctgcaggaggagaccagggcgaaattggccttggggtcccgggtgcgagccatggaggct
gaggcagccgggctgcgtgagcagctggaggaggaggcagctgccagggaacgggcgggc
cgtgaactgcagactgcccaggcccagctttccgagtggcggcggcgccaggaggaggag
gcaggggcactggaggcaggggaggaggcacggcgccgggcagcccgggaggccgaggcc
ctgacccagcgcctggcagaaaagacagagaccgtggatcggctggagcggggccgccgc
cggctgcagcaggagctggacgacgccaccatggacctggagcagcagcggcagcttgtg
agcaccctggagaagaagcagcgcaagtttgaccagcttctggcagaggagaaggcagct
gtacttcgggcagtggaggaacgtgagcgggccgaggcagagggccgggagcgtgaggct
cgggccctgtcactgacacgggcactggaggaggagcaggaggcacgtgaggagctggag
cggcagaaccgggccctgcgggctgagctggaggcactgctgagcagcaaggatgacgtc
ggcaagagcgtgcatgagctggaacgagcctgccgggtagcagaacaggcagccaatgat
ctgcgagcacaggtgacagaactggaggatgagctgacagcggccgaggatgccaagctg
cgtctggaggtgactgtgcaggctctcaagactcagcatgagcgtgacctgcagggccgt
gatgaggctggtgaagagaggcggaggcagctggccaagcagctgagagatgcagaggtg
gagcgggatgaggagcggaagcagcgcactctggccgtggctgcccgcaagaagctggag
ggagagctggaggagctgaaggctcagatggcctctgccggccagggcaaggaggaggcg
gtgaagcagcttcgcaagatgcaggcccagatgaaggagctatggcgggaggtggaggag
acacgcacctcccgggaggagatcttctcccagaatcgggaaagtgaaaagcgcctcaag
ggcctggaggctgaggtgctgcggctgcaggaggaactggccgcctcggaccgtgctcgg
cggcaggcccagcaggaccgggatgagatggcagatgaggtggccaatggtaaccttagc
aaggcagccattctggaggagaagcgtcagctggaggggcgcctggggcagttggaggaa
gagctggaggaggagcagagcaactcggagctgctcaatgaccgctaccgcaagctgctc
ctgcaggtagagtcactgaccacagagctgtcagctgagcgcagtttctcagccaaggca
gagagcgggcggcagcagctggaacggcagatccaggagctacggggacgcctgggtgag
gaggatgctggggcccgtgcccgccacaagatgaccattgctgcccttgagtctaagttg
gcccaggctgaggagcagctagagcaagagaccagagagcgcatcctctctggaaagctg
gtgcgcagagctgagaagcggcttaaagaggtggtgctccaggtggaggaggagcggagg
gtggctgaccagctccgggaccagctggagaagggaaaccttcgagtcaagcagctgaag
cggcagctggaggaggccgaggaggaggcatcccgggctcaggccggccgccggaggctg
cagcgtgagctggaagatgtcacagagtcggccgagtccatgaaccgtgaagtgaccaca
ctgaggaaccggcttcgacgcggccccctcaccttcaccacccgcacggtgcgccaggtc
ttccgactagaggagggcgtggcatccgacgaggaggcagaggaagcacagcctgggtct
gggccatccccggagcctgaggggtccccaccagcccacccccagtga

DBGET integrated database retrieval system