KEGG   Homo sapiens (human): 79799Help
Entry
79799             CDS       T01001                                 

Gene name
UGT2A3
Definition
UDP glucuronosyltransferase 2 family, polypeptide A3 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    79799 (UGT2A3)
   00053 Ascorbate and aldarate metabolism
    79799 (UGT2A3)
   00500 Starch and sucrose metabolism
    79799 (UGT2A3)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    79799 (UGT2A3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    79799 (UGT2A3)
   00860 Porphyrin and chlorophyll metabolism
    79799 (UGT2A3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    79799 (UGT2A3)
   00982 Drug metabolism - cytochrome P450
    79799 (UGT2A3)
   00983 Drug metabolism - other enzymes
    79799 (UGT2A3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    79799 (UGT2A3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     79799 (UGT2A3)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   79799 (UGT2A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q13.2
AA seq 527 aa AA seqDB search
MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
PSLIDYRKPSALKFEVVHMPQDRTEENEIFVDLALNVLPGLSTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVLFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgacaagtcagctttggtatttctgctcctgcagctcttctgtgttggctgt
ggattctgtgggaaagtcctggtgtggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaagagctcatagtgagaggccatgaggtaacagtattgactcactcaaag
ccttcgttaattgactacaggaagccttctgcattgaaatttgaggtggtccatatgcca
caggacagaacagaagaaaatgaaatatttgttgacctagctctgaatgtcttgccaggc
ttatcaacctggcaatcagttataaaattaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacgcttatgaagaagctacaggaa
accaactacgatgtaatgcttatagaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtgctcacacttagaatttctgtaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtgcctatgacaggactaaca
gacagaatgacctttctggaaagagtaaaaaattcaatgctttcagttttgttccacttc
tggattcaggattacgactatcatttttgggaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatttcctcaaccataccaacctaactttgagtttgttggaggattgcactgt
aaacctgccaaagctttgcctaaggaaatggaaaattttgtccagagttcaggggaagat
ggtattgtggtgttttctctggggtcactgtttcaaaatgttacagaagaaaaggctaat
atcattgcttcagcccttgcccagatcccacagaaggtgttatggaggtacaaaggaaaa
aaaccatccacattaggagccaatactcggctgtatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaatgaatgggatctatgaa
gctatttaccatggggtccctatggtgggagttcccatatttggtgatcagcttgataac
atagctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagc
gaagatttactgagggctttgagaacagtcattaccgattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaacctgtaaagcccctagatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccatgac
ctcacctggttccagcactactctatagatgtgattgggttcctgctggcctgtgtggca
actgctatattcttgttcacaaaatgttttttattttcctgtcaaaaatttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system