KEGG   Homo sapiens (human): 80824Help
Entry
80824             CDS       T01001                                 

Gene name
DUSP16, MKP-7, MKP7
Definition
dual specificity phosphatase 16 (EC:3.1.3.16 3.1.3.48)
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 665 aa AA seqDB search
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKLQTARPSDSQ
SKRLHSVRTSSSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWH
SDILAPQTSTPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSME
IIEVS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgagatgattggaactcaaattgttactgagaggttggtggctctgctggaa
agtggaacggaaaaagtgctgctaattgatagccggccatttgtggaatacaatacatcc
cacattttggaagccattaatatcaactgctccaagcttatgaagcgaaggttgcaacag
gacaaagtgttaattacagagctcatccagcattcagcgaaacataaggttgacattgat
tgcagtcagaaggttgtagtttacgatcaaagctcccaagatgttgcctctctctcttca
gactgttttctcactgtacttctgggtaaactggagaagagcttcaactctgttcacctg
cttgcaggtgggtttgctgagttctctcgttgtttccctggcctctgtgaaggaaaatcc
actctagtccctacctgcatttctcagccttgcttacctgttgccaacattgggccaacc
cgaattcttcccaatctttatcttggctgccagcgagatgtcctcaacaaggagctgatg
cagcagaatgggattggttatgtgttaaatgccagcaatacctgtccaaagcctgacttt
atccccgagtctcatttcctgcgtgtgcctgtgaatgacagcttttgtgagaaaattttg
ccgtggttggacaaatcagtagatttcattgagaaagcaaaagcctccaatggatgtgtt
ctagtgcactgtttagctgggatctcccgctccgccaccatcgctatcgcctacatcatg
aagaggatggacatgtctttagatgaagcttacagatttgtgaaagaaaaaagacctact
atatctccaaacttcaattttctgggccaactcctggactatgagaagaagattaagaac
cagactggagcatcagggccaaagagcaaactcaagctgctgcacctggagaagccaaat
gaacctgtccctgctgtctcagagggtggacagaaaagcgagacgcccctcagtccaccc
tgtgccgactctgctacctcagaggcagcaggacaaaggcccgtgcatcccgccagcgtg
cccagcgtgcccagcgtgcagccgtcgctgttagaggacagcccgctggtacaggcgctc
agtgggctgcacctgtccgcagacaggctggaagacagcaataagctcaagcgttccttc
tctctggatatcaaatcagtttcatattcagccagcatggcagcatccttacatggcttc
tcctcatcagaagatgctttggaatactacaaaccttccactactctggatgggaccaac
aagctatgccagttctcccctgttcaggaactatcggagcagactcccgaaaccagtcct
gataaggaggaagccagcatccccaagaagctgcagaccgccaggccttcagacagccag
agcaagcgattgcattcggtcagaaccagcagcagtggcaccgcccagaggtccctttta
tctccactgcatcgaagtgggagcgtggaggacaattaccacaccagcttccttttcggc
ctttccaccagccagcagcacctcacgaagtctgctggcctgggccttaagggctggcac
tcggatatcttggccccccagacctctaccccttccctgaccagcagctggtattttgcc
acagagtcctcacacttctactctgcctcagccatctacggaggcagtgccagttactct
gcctacagctgcagccagctgcccacttgcggagaccaagtctattctgtgcgcaggcgg
cagaagccaagtgacagagctgactcgcggcggagctggcatgaagagagcccctttgaa
aagcagtttaaacgcagaagctgccaaatggaatttggagagagcatcatgtcagagaac
aggtcacgggaagagctggggaaagtgggcagtcagtctagcttttcgggcagcatggaa
atcattgaggtctcctga

DBGET integrated database retrieval system