KEGG   Homo sapiens (human): 81Help
Entry
81                CDS       T01001                                 

Gene name
ACTN4, ACTININ-4, FSGS, FSGS1
Definition
actinin, alpha 4
Orthology
K05699  
actinin alpha
Organism
hsa  Homo sapiens (human)
Pathway
Focal adhesion
Adherens junction
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Amoebiasis
Viral carcinogenesis
Systemic lupus erythematosus
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Disease
H00626  
Nephrotic syndrome and focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    81 (ACTN4)
  Cellular commiunity
   04510 Focal adhesion
    81 (ACTN4)
   04520 Adherens junction
    81 (ACTN4)
   04530 Tight junction
    81 (ACTN4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    81 (ACTN4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    81 (ACTN4)
  Immune diseases
   05322 Systemic lupus erythematosus
    81 (ACTN4)
  Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    81 (ACTN4)
  Infectious diseases
   05146 Amoebiasis
    81 (ACTN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81 (ACTN4)
  Exosomal proteins of colorectal cancer cells
   81 (ACTN4)
  Exosomal proteins of bladder cancer cells
   81 (ACTN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 911 aa AA seqDB search
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggtggactaccacgcggcgaaccagtcgtaccagtacggccccagcagcgcgggcaat
ggcgctggcggcgggggcagcatgggcgactacatggcccaggaggacgactgggaccgg
gacctgctgctggacccggcctgggagaagcagcagcgcaagaccttcacggcatggtgc
aactcccacctgcggaaggcaggcacacagatcgagaacattgatgaggacttccgagac
gggctcaagctcatgctgctcctggaggtcatatcaggggagcggttacctaagccggag
cgggggaagatgagagtgcacaaaatcaacaatgtgaacaaagcgctggactttattgcc
agcaaaggcgtcaagctggtctccatcggggcagaagagattgtggacggcaacgcaaag
atgaccctgggaatgatctggaccatcatccttaggttcgccatccaggacatctccgtg
gaagagacctcggccaaggaagggctccttctctggtgccagagaaagacagccccgtat
aagaacgtcaatgtgcagaacttccacatcagctggaaggatggtcttgccttcaatgcc
ctgatccaccggcacagaccagagctgattgagtatgacaagctgaggaaggacgaccct
gtcaccaacctgaacaatgccttcgaagtggctgagaaatacctcgacatccccaagatg
ctggatgcagaggacatcgtgaacacggcccggcccgacgagaaggccataatgacctat
gtgtccagcttctaccatgccttttcaggagcgcagaaggctgaaactgccgccaaccgg
atctgtaaggtgctggctgtcaaccaagagaacgagcacctgatggaggactacgagaag
ctggccagcgacctcctggagtggatccggcgcaccatcccctggctggaggaccgtgtg
ccccaaaagactatccaggagatgcagcagaagctggaggacttccgcgactaccggcgt
gtgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacgctg
cagaccaagctgcgcctcagcaaccggcccgccttcatgccctccgagggcaagatggtc
tcggacatcaacaatggctggcagcacttggagcaggctgagaagggctacgaggagtgg
ctgctgaatgagatccgcaggctggagcggctcgaccacctggcagagaagttccggcag
aaggcctccatccacgaggcctggactgacgggaaggaagccatgctgaagcaccgggac
tacgagacggccacactatcggacatcaaagccctcattcgcaagcacgaggccttcgag
agcgacctggctgcgcaccaggaccgcgtggagcagatcgccgccattgcccaggagctc
aacgagctggattactacgactcccacaatgtcaacacccggtgccagaagatctgtgac
cagtgggacgccctcggctctctgacacatagtcgcagggaagccctggagaaaacagag
aagcagctggaggccatcgaccagctgcacctggaatacgccaagcgcgcggcccccttc
aacaactggatggagagcgccatggaggacctccaggacatgttcatcgtccataccatc
gaggagattgagggcctgatctcagcccatgaccagttcaagtccaccctgccggacgcc
gatagggagcgcgaggccatcctggccatccacaaggaggcccagaggatcgctgagagc
aaccacatcaagctgtcgggcagcaacccctacaccaccgtcaccccgcaaatcatcaac
tccaagtgggagaaggtgcagcagctggtgccaaaacgggaccatgccctcctggaggag
cagagcaagcagcagtccaacgagcacctgcgccgccagttcgccagccaggccaatgtt
gtggggccctggatccagaccaagatggaggagatcgggcgcatctccattgagatgaac
gggaccctggaggaccagctgagccacctgaagcagtatgaacgcagcatcgtggactac
aagcccaacctggacctgctggagcagcagcaccagctcatccaggaggccctcatcttc
gacaacaagcacaccaactataccatggagcacatccgcgtgggctgggagcagctgctc
accaccattgcccgcaccatcaacgaggtggagaaccagatcctcacccgcgacgccaag
ggcatcagccaggagcagatgcaggagttccgggcgtccttcaaccacttcgacaaggat
catggcggggcgctggggcccgaggagttcaaggcctgcctcatcagcctgggctacgac
gtggagaacgaccggcagggtgaggccgagttcaaccgcatcatgagcctggtcgacccc
aaccatagcggccttgtgaccttccaagccttcatcgacttcatgtcgcgggagaccacc
gacacggacacggctgaccaggtcatcgcttccttcaaggtcttagcaggggacaagaac
ttcatcacagctgaggagctgcggagagagctgccccccgaccaggccgagtactgcatc
gcccgcatggcgccataccagggccctgacgccgtgcccggtgccctcgactacaagtcc
ttctccacggccttgtatggcgagagcgacctgtga

DBGET integrated database retrieval system