KEGG   Homo sapiens (human): 81027Help
Entry
81027             CDS       T01001                                 

Gene name
TUBB1
Definition
tubulin, beta 1 class VI
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    81027 (TUBB1)
  Cellular commiunity
   04540 Gap junction
    81027 (TUBB1)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    81027 (TUBB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81027 (TUBB1)
  Exosomal proteins of colorectal cancer cells
   81027 (TUBB1)
  Exosomal proteins of bladder cancer cells
   81027 (TUBB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.32
AA seq 451 aa AA seqDB search
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYV
PRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVV
RHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVV
EPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTM
AACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRG
LSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVS
EYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaattgtccatattcagattggccagtgtggcaaccagatcggagccaagttc
tgggagatgattggtgaggaacacgggatcgacttggctgggagcgaccgcggggcctcg
gccttgcagctggagagaatcagcgtgtactacaacgaagcctacggtaggaaatatgtg
ccccgagcagtcttggtggacctagaacctgggacgatggacagcattcgatctagcaaa
ttaggagctctctttcaacccgacagttttgtccatggtaactctggggctggcaacaac
tgggccaaaggccactacacggagggagccgagctgatcgagaatgtcctagaggtggtg
aggcacgagagtgagagctgtgactgcctgcagggcttccagatcgtccactccctgggc
gggggcacaggctccgggatgggcactctgctcatgaacaagattagagaggagtacccg
gaccggatcatgaattccttcagcgtcatgccttctcccaaggtgtcggacactgtggtg
gagccctacaacgcggttctgtctatccaccagctgattgagaatgcagatgcctgtttc
tgcattgacaatgaggccctctatgacatctgcttccgtaccctgaagctgacgacaccc
acctatggggatctcaaccacctagtgtccttgaccatgagcggcataaccacctccctc
cggttcccgggtcagctcaacgcagacctgcgcaagctggcggtgaacatggtccccttc
ccccgcctgcacttctttatgcccggctttgccccactcacggcccagggcagccagcag
taccgagccctctccgtggccgagctcacccagcagatgttcgatgcccgcaataccatg
gctgcctgtgacctccgccgtggccgctacctcacagtggcctgcattttccggggcaag
atgtccaccaaggaagtggaccagcaactgctctccgtgcagaccaggaacagcagctgc
tttgtggagtggattcccaacaacgtcaaggtggctgtctgcgacatcccgccccggggg
ctgagcatggccgccaccttcattggcaacaacacggccatccaagagatctttaatagg
gtctctgagcatttctcagccatgttcaaaaggaaagcttttgtgcactggtacaccagc
gaagggatggacataaacgaatttggggaagctgaaaataacatccatgatttggtatcc
gagtaccaacaatttcaagatgccaaagcagttctagaggaagatgaagaggtcacggag
gaggcagaaatggagccagaagataagggacattaa

DBGET integrated database retrieval system