KEGG   Homo sapiens (human): 81029Help
Entry
81029             CDS       T01001                                 

Gene name
WNT5B
Definition
wingless-type MMTV integration site family, member 5B
Orthology
K00444  
wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    81029 (WNT5B)
   04340 Hedgehog signaling pathway
    81029 (WNT5B)
   04390 Hippo signaling pathway
    81029 (WNT5B)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    81029 (WNT5B)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    81029 (WNT5B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    81029 (WNT5B)
   05205 Proteoglycans in cancer
    81029 (WNT5B)
   05217 Basal cell carcinoma
    81029 (WNT5B)
  Infectious diseases
   05166 HTLV-I infection
    81029 (WNT5B)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  81029 (WNT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.3
AA seq 359 aa AA seqDB search
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaattgcagcacagcggacaacgca
tctgtctttgggagagtcatgcagataggcagccgagagaccgccttcacccacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagcgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctat
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaggtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

DBGET integrated database retrieval system