KEGG   Homo sapiens (human): 81029Help
Entry
81029             CDS       T01001                                 

Gene name
WNT5B
Definition
wingless-type MMTV integration site family, member 5B
Orthology
K00444  
wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Basal cell carcinoma [PATH:hsa05217]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.3
AA seq 359 aa AA seqDB search
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaattgcagcacagcggacaacgca
tctgtctttgggagagtcatgcagataggcagccgagagaccgccttcacccacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagcgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctat
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaggtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

DBGET integrated database retrieval system