KEGG   Homo sapiens (human): 81033Help
Entry
81033             CDS       T01001                                 

Gene name
KCNH6, ERG-2, ERG2, HERG2, Kv11.2, hERG-2
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 6
  KO
K04909  
potassium voltage-gated channel Eag-related subfamily H member 6
Organism
hsa  Homo sapiens (human)
Drug target
Flecainide (DG00201): 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   81033 (KCNH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q23.3
AA seq 994 aa AA seqDB search
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKLEVTFNLRDAAGG
LHSSPRQAPGSQDHQGFFLSDNQSGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHP
DAAPPLSISDASGLWPELLQEMPPRHSPQSPQEDPDCWPLKLGSRLEQLQAQMNRLESRV
SSDLSRILQLLQKPMPQGHASYILEAPASNDLALVPIASETTSPGPRLPQGFLPPAQTPS
YGDLDDCSPKHRNSSPRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICG
PCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWGH
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccgcaggggccacgtcgctccccaaaacacttacctggacaccatcatccgc
aagttcgagggccaaagtcggaagttcctgattgccaatgctcagatggagaactgcgcc
atcatttactgcaacgacggcttctgcgaactcttcggctactcccgagtggaggtgatg
cagcaaccctgcacctgcgacttcctcacaggccccaacacaccaagcagcgccgtgtcc
cgcctagcgcaggccctgctgggggctgaggagtgcaaggtggacatcctctactaccgc
aaggatgcctccagcttccgctgcctggtagatgtggtgcccgtgaagaacgaggacggg
gctgtcatcatgttcattctcaacttcgaggacctggcccagctcctggccaagtgcagc
agccgcagcttgtcccagcgcctgttgtcccagagcttcctgggctccgagggctctcat
ggcaggccaggcggaccagggccaggcacaggcaggggcaagtacaggaccatcagccag
atcccacagttcacgctcaacttcgtggagttcaacttggagaagcaccgctccagctcc
accacggagattgagatcatcgcgccccataaggtggtggagcggacacagaacgtcact
gagaaggtcacccaggtcctgtccctgggcgcggatgtgctgccggagtacaagctgcag
gcgccgcgcatccaccgctggaccatcctgcactacagccccttcaaggccgtgtgggac
tggctcatcctgctgctggtcatctacacggctgtcttcacgccctactcagccgccttc
ctgctcagcgatcaggacgaatcacggcgtggggcctgcagctatacctgcagtcccctc
actgtggtggatctcatcgtggacatcatgttcgtcgtggacatcgtcatcaacttccgc
accacctatgtcaacaccaatgatgaggtggtcagccacccccgccgcatcgccgtccac
tacttcaagggctggttcctcattgacatggtggccgccatccctttcgacctcctgatc
ttccgcactggctccgatgagaccacaaccctgattgggctattgaagacagcgcggctg
ctgcggctggtgcgcgtagcacggaagctggaccgctactctgagtatggggcggctgtg
ctcttcttgctcatgtgcaccttcgcgctcatagcgcactggctggcctgcatctggtac
gccatcggcaatgtggagcggccctacctagaacacaagatcggctggctggacagcctg
ggtgtgcagcttggcaagcgctacaacggcagcgacccagcctcgggcccctcggtgcag
gacaagtatgtcacagccctctacttcaccttcagcagcctcaccagcgtgggcttcggc
aatgtctcgcccaacaccaactccgagaaggtcttctccatctgcgtcatgctcatcggc
tccctgatgtacgccagcatcttcgggaacgtgtccgcgatcatccagcgcctgtactcg
ggcaccgcgcgctaccacacgcagatgctgcgtgtcaaggagttcatccgcttccaccag
atccccaacccactgcgccagcgcctggaggagtatttccagcacgcctggtcctacacc
aatggcattgacatgaacgcggtgctgaagggcttccccgagtgcctgcaggctgacatc
tgcctgcacctgcaccgcgcactgctgcagcactgcccagctttcagcggcgccggcaag
ggctgcctgcgcgcgctagccgtcaagttcaagaccacccacgcgccgcctggggacacg
ctggtgcacctcggcgacgtgctctccaccctctacttcatctcccgaggctccatcgag
atcctgcgcgacgacgtggtcgtggccatcctaggaaagaatgacatctttggggaaccc
gtcagcctccatgcccagccaggcaagtccagtgcagacgtgcgggctctgacctactgc
gacctgcacaagatccagcgggcagatctgctggaggtgctggacatgtacccggccttt
gcggagagcttctggagtaagctggaggtcaccttcaacctgcgggacgcagccgggggt
ctccactcatccccccgacaggctcctggcagccaagaccaccaaggtttctttctcagt
gacaaccagtcagggtctccccatgagctggggccccagttcccctctaagggctacagc
ctcctgggtcctgggagccagaactccatgggggcaggaccttgtgctccagggcaccca
gatgcagcccctcccctgagcatctcagatgcatctggcctctggcctgagctactgcag
gaaatgcccccaaggcacagcccccaaagccctcaggaagacccagattgctggcctctg
aagctgggctccaggctagagcagctccaggcccagatgaacaggctggagtcccgcgtg
tcctcagacctcagccgcatcttgcagctcctccagaagcccatgccccagggccacgcc
agctacattctggaagcccctgcctccaatgacctggccttggttcctatagcctcggag
acgacgagtccagggcccaggctgccccagggctttctgcctcctgcacagaccccaagc
tatggagacttggatgactgtagtccaaagcacaggaactcctcccccaggatgcctcac
ctggctgtggcaacggacaaaactctggcaccatcctcagaacaggaacagcctgagggg
ctctggccacccctagcctcacctctacatcccctggaagtacaaggactcatctgtggt
ccctgcttctcctccctccctgaacaccttggctctgttcccaagcagctggacttccag
agacatggctcagatcctggatttgcagggagttggggccactga

DBGET integrated database retrieval system