KEGG   Homo sapiens (human): 811Help
Entry
811               CDS       T01001                                 

Gene name
CALR, CRT, HEL-S-99n, RO, SSA, cC1qR
Definition
(RefSeq) calreticulin
  KO
K08057  
calreticulin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Phagosome
Antigen processing and presentation
Chagas disease (American trypanosomiasis)
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    811 (CALR)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    811 (CALR)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    811 (CALR)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    811 (CALR)
   05142 Chagas disease (American trypanosomiasis)
    811 (CALR)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   811 (CALR)
Lectins [BR:hsa04091]
 Calnexin / calreticulin
  811 (CALR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.13
AA seq 417 aa AA seqDB search
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgctatccgtgccgctgctgctcggcctcctcggcctggccgtcgccgagcctgcc
gtctacttcaaggagcagtttctggacggagacgggtggacttcccgctggatcgaatcc
aaacacaagtcagattttggcaaattcgttctcagttccggcaagttctacggtgacgag
gagaaagataaaggtttgcagacaagccaggatgcacgcttttatgctctgtcggccagt
ttcgagcctttcagcaacaaaggccagacgctggtggtgcagttcacggtgaaacatgag
cagaacatcgactgtgggggcggctatgtgaagctgtttcctaatagtttggaccagaca
gacatgcacggagactcagaatacaacatcatgtttggtcccgacatctgtggccctggc
accaagaaggttcatgtcatcttcaactacaagggcaagaacgtgctgatcaacaaggac
atccgttgcaaggatgatgagtttacacacctgtacacactgattgtgcggccagacaac
acctatgaggtgaagattgacaacagccaggtggagtccggctccttggaagacgattgg
gacttcctgccacccaagaagataaaggatcctgatgcttcaaaaccggaagactgggat
gagcgggccaagatcgatgatcccacagactccaagcctgaggactgggacaagcccgag
catatccctgaccctgatgctaagaagcccgaggactgggatgaagagatggacggagag
tgggaacccccagtgattcagaaccctgagtacaagggtgagtggaagccccggcagatc
gacaacccagattacaagggcacttggatccacccagaaattgacaaccccgagtattct
cccgatcccagtatctatgcctatgataactttggcgtgctgggcctggacctctggcag
gtcaagtctggcaccatctttgacaacttcctcatcaccaacgatgaggcatacgctgag
gagtttggcaacgagacgtggggcgtaacaaaggcagcagagaaacaaatgaaggacaaa
caggacgaggagcagaggcttaaggaggaggaagaagacaagaaacgcaaagaggaggag
gaggcagaggacaaggaggatgatgaggacaaagatgaggatgaggaggatgaggaggac
aaggaggaagatgaggaggaagatgtccccggccaggccaaggacgagctgtag

DBGET integrated database retrieval system