KEGG   Homo sapiens (human): 814Help
Entry
814               CDS       T01001                                 

Gene name
CAMK4, CaMK_IV, CaMK-GR, IV, caMK
Definition
calcium/calmodulin-dependent protein kinase IV (EC:2.7.11.17)
Orthology
K05869  
calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cAMP signaling pathway
Osteoclast differentiation
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    814 (CAMK4)
   04024 cAMP signaling pathway
    814 (CAMK4)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    814 (CAMK4)
  Nervous system
   04725 Cholinergic synapse
    814 (CAMK4)
   04720 Long-term potentiation
    814 (CAMK4)
   04722 Neurotrophin signaling pathway
    814 (CAMK4)
  Development
   04380 Osteoclast differentiation
    814 (CAMK4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    814 (CAMK4)
   05034 Alcoholism
    814 (CAMK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     814 (CAMK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK1 family [OT]
   814 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q21.3
AA seq 473 aa AA seqDB search
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgccgttaaacaaatcctggaggcagttgcttatctacatgaaaatgggatt
gtccatcgtgatctcaaaccagagaatcttctttatgcaactccagccccagatgcacca
ctcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacatttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagctccaagaattc
aatgcccggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcccgcctggga
agtgccagcagcagccatggcagcatccaggagagccacaaggctagccgagacccttct
ccaatccaagatggcaacgaggacatgaaagctattccagaaggagagaaaattcaaggc
gatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggtgcagatataaatgctgaagaggcccccaaaatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagaggagggcctagcagaggagaag
ctgaagactgtggaggaggcagcagctcccagagaagggcaaggaagctctgctgtgggt
tttgaagttccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system