KEGG   Homo sapiens (human): 81579Help
Entry
81579             CDS       T01001                                 

Gene name
PLA2G12A, GXII, PLA2G12, ROSSY
Definition
phospholipase A2, group XIIA (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    81579 (PLA2G12A)
   00565 Ether lipid metabolism
    81579 (PLA2G12A)
   00590 Arachidonic acid metabolism
    81579 (PLA2G12A)
   00591 Linoleic acid metabolism
    81579 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    81579 (PLA2G12A)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    81579 (PLA2G12A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    81579 (PLA2G12A)
  Digestive system
   04972 Pancreatic secretion
    81579 (PLA2G12A)
   04975 Fat digestion and absorption
    81579 (PLA2G12A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     81579 (PLA2G12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q25
AA seq 189 aa AA seqDB search
MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGED
GLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKS
KNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACR
CHYEEKTDL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctctcgcgccccgcgctcaccctcctgctcctcctcatggccgctgttgtc
aggtgccaggagcaggcccagaccaccgactggagagccaccctgaagaccatccggaac
ggcgttcataagatagacacgtacctgaacgccgccttggacctcctgggaggcgaggac
ggtctctgccagtataaatgcagtgacggatctaagcctttcccacgttatggttataaa
ccctccccaccgaatggatgtggctctccactgtttggtgttcatcttaacattggtatc
ccttccctgacaaagtgttgcaaccaacacgacaggtgctatgagacctgtggcaaaagc
aagaatgactgtgatgaagaattccagtattgcctctccaagatctgccgagatgtacag
aaaacactaggactaactcagcatgttcaggcatgtgaaacaacagtggagctcttgttt
gacagtgttatacatttaggttgtaaaccatatctggacagccaacgagccgcatgcagg
tgtcattatgaagaaaaaactgatctttaa

DBGET integrated database retrieval system