KEGG   Homo sapiens (human): 816Help
Entry
816               CDS       T01001                                 

Gene name
CAMK2B, CAM2, CAMK2, CAMKB
Definition
calcium/calmodulin-dependent protein kinase II beta (EC:2.7.11.17)
Orthology
K04515  
calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
cAMP signaling pathway
HIF-1 signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Wnt signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Oxytocin signaling pathway
Gastric acid secretion
Amphetamine addiction
Tuberculosis
Proteoglycans in cancer
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    816 (CAMK2B)
   04310 Wnt signaling pathway
    816 (CAMK2B)
   04066 HIF-1 signaling pathway
    816 (CAMK2B)
   04020 Calcium signaling pathway
    816 (CAMK2B)
   04024 cAMP signaling pathway
    816 (CAMK2B)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    816 (CAMK2B)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    816 (CAMK2B)
   04912 GnRH signaling pathway
    816 (CAMK2B)
   04921 Oxytocin signaling pathway
    816 (CAMK2B)
   04916 Melanogenesis
    816 (CAMK2B)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    816 (CAMK2B)
  Digestive system
   04971 Gastric acid secretion
    816 (CAMK2B)
  Nervous system
   04725 Cholinergic synapse
    816 (CAMK2B)
   04728 Dopaminergic synapse
    816 (CAMK2B)
   04720 Long-term potentiation
    816 (CAMK2B)
   04722 Neurotrophin signaling pathway
    816 (CAMK2B)
  Sensory system
   04740 Olfactory transduction
    816 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    816 (CAMK2B)
  Environmental adaptation
   04713 Circadian entrainment
    816 (CAMK2B)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    816 (CAMK2B)
   05214 Glioma
    816 (CAMK2B)
  Substance dependence
   05031 Amphetamine addiction
    816 (CAMK2B)
  Infectious diseases
   05152 Tuberculosis
    816 (CAMK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     816 (CAMK2B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMK2 family
   816 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3-p14.1
AA seq 666 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCPSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagcgaggctgatgccagtcactgtatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgcttctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggccta
gctatcgaggtgcagggggaccagcaggcatggtttggtttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcctgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggtgcctatgacttcccgtcccctgagtgggacacc
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcatcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaatacc
accatagaggatgaagacgctaaagcccccagggtccccgacatcctgagctcagtgagg
aggggctcgggagccccagaagccgaggggcccctgccctgcccatctccggctcccttt
agccccctgccagccccatcccccaggatctctgacatcctgaactctgtgagaaggggt
tcaggaaccccagaagccgagggccccctctcagcggggcccccgccctgcctgtctccg
gctctcctaggccccctgtcctccccgtcccccaggatctctgacatcctgaactctgtg
aggaggggctcagggaccccagaagccgagggcccctcgccagtggggcccccgccctgc
ccatctccgactatccctggccccctgcccaccccatcccggaagcaggagatcattaag
accacggagcagctcatcgaggccgtcaacaacggtgactttgaggcctacgcgaaaatc
tgtgacccagggctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatg
gacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacg
accatcctgaacccacacgtgcacgtcattggagaggatgccgcctgcatcgcttacatc
cggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggagacc
cgcgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggcgcg
cctgtggccccgctgcagtga

DBGET integrated database retrieval system