KEGG   Homo sapiens (human): 81848Help
Entry
81848             CDS       T01001                                 

Gene name
SPRY4, HH17
Definition
sprouty homolog 4 (Drosophila)
Orthology
K17385  
protein sprouty homolog 4
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Disease
H00255  
Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    81848 (SPRY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.3
AA seq 299 aa AA seqDB search
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV
ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW
VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA
LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggagcccccgatcccacagagcgcccccttgactcccaactcagtcatggtccagccc
cttcttgacagccggatgtcccacagccggctccagcacccactcaccatcctacccatt
gaccaggtgaagaccagccatgtggagaatgactacatagacaaccctagcctggccctg
accaccggcccaaagcggacccggggcggggccccagagctggccccgacgcccgcccgc
tgtgaccaggatgtcacccaccattggatctccttcagcgggcgccccagctctgtgagc
agcagcagcagcacatcctctgaccaacggctcttagaccacatggcaccaccacccgtg
gctgaccaggcctcaccaagggctgtgcgcatccagcccaaggtggtccactgccagccg
ctggacctcaagggcccggcggtcccacccgagctggacaagcacttcttgctgtgcgag
gcctgtgggaagtgtaaatgcaaggagtgtgcatccccccggacgttgccttcctgctgg
gtctgcaaccaggagtgcctgtgctcagcccagactctggtcaactatggcacgtgcatg
tgtttggtgcagggcatcttctaccactgcacgaatgaggacgatgagggctcctgcgct
gaccacccctgctcctgctcccgctccaactgctgcgcccgctggtccttcatgggtgct
ctctccgtggtgctgccctgcctgctctgctacctgcctgccaccggctgcgtgaagctg
gcccagcgtggctacgaccgtctgcgccgccctggttgccgctgcaagcacacgaacagc
gtcatctgcaaagcagccagcggggatgccaagaccagcaggcccgacaagcctttctga

DBGET integrated database retrieval system