KEGG   Homo sapiens (human): 821Help
Entry
821               CDS       T01001                                 

Gene name
CANX, CNX, IP90, P90
Definition
(RefSeq) calnexin
  KO
K08054  
calnexin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Phagosome
Antigen processing and presentation
Thyroid hormone synthesis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    821 (CANX)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    821 (CANX)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    821 (CANX)
  Endocrine system
   04918 Thyroid hormone synthesis
    821 (CANX)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    821 (CANX)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   821 (CANX)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    821 (CANX)
Lectins [BR:hsa04091]
 Calnexin / calreticulin
  821 (CANX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P27824(Tbio)
UniProt: 
Position
5q35.3
AA seq 592 aa AA seqDB search
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRC
ESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggaagggaagtggttgctgtgtatgttactggtgcttggaactgctattgttgaggct
catgatggacatgatgatgatgtgattgatattgaggatgaccttgacgatgtcattgaa
gaggtagaagactcaaaaccagataccactgctcctccttcatctcccaaggttacttac
aaagctccagttccaacaggggaagtatattttgctgattcttttgacagaggaactctg
tcagggtggattttatccaaagccaagaaagacgataccgatgatgaaattgccaaatat
gatggaaagtgggaggtagaggaaatgaaggagtcaaagcttccaggtgataaaggactt
gtgttgatgtctcgggccaagcatcatgccatctctgctaaactgaacaagcccttcctg
tttgacaccaagcctctcattgttcagtatgaggttaatttccaaaatggaatagaatgt
ggtggtgcctatgtgaaactgctttctaaaacaccagaactcaacctggatcagttccat
gacaagaccccttatacgattatgtttggtccagataaatgtggagaggactataaactg
cacttcatcttccgacacaaaaaccccaaaacgggtatctatgaagaaaaacatgctaag
aggccagatgcagatctgaagacctattttactgataagaaaacacatctttacacacta
atcttgaatccagataatagttttgaaatactggttgaccaatctgtggtgaatagtgga
aatctgctcaatgacatgactcctcctgtaaatccttcacgtgaaattgaggacccagaa
gaccggaagcccgaggattgggatgaaagaccaaaaatcccagatccagaagctgtcaag
ccagatgactgggatgaagatgcccctgctaagattccagatgaagaggccacaaaaccc
gaaggctggttagatgatgagcctgagtacgtacctgatccagacgcagagaaacctgag
gattgggatgaagacatggatggagaatgggaggctcctcagattgccaaccctagatgt
gagtcagctcctggatgtggtgtctggcagcgacctgtgattgacaaccccaattataaa
ggcaaatggaagcctcctatgattgacaatcccagttaccagggaatctggaaacccagg
aaaataccaaatccagatttctttgaagatctggaacctttcagaatgactccttttagt
gctattggtttggagctgtggtccatgacctctgacattttttttgacaactttatcatt
tgtgctgatcgaagaatagttgatgattgggccaatgatggatggggcctgaagaaagct
gctgatggggctgctgagccaggcgttgtggggcagatgatcgaggcagctgaagagcgc
ccgtggctgtgggtagtctatattctaactgtagcccttcctgtgttcctggttatcctc
ttctgctgttctggaaagaaacagaccagtggtatggagtataagaaaactgatgcacct
caaccggatgtgaaggaagaggaagaagagaaggaagaggaaaaggacaagggagatgag
gaggaggaaggagaagagaaacttgaagagaaacagaaaagtgatgctgaagaagatggt
ggcactgtcagtcaagaggaggaagacagaaaacctaaagcagaggaggatgaaattttg
aacagatcaccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system