KEGG   Homo sapiens (human): 823Help
Entry
823               CDS       T01001                                 

Gene name
CAPN1, CANP, CANP1, CANPL1, muCANP, muCL
Definition
calpain 1, (mu/I) large subunit (EC:3.4.22.52)
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    823 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    823 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    823 (CAPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     823 (CAPN1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   823 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 714 aa AA seqDB search
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcacgccggtgtactgcactggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtaccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggaactgctgtcaaacccccagttcattgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacaccctcctgcaccgagtggttccgcacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gttaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcactttcaagaagttggtgaagggccatgcctactctgtgaccggggccaag
caggtgaactaccgaggccaggtggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctccgggtcaagatggaggacggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccgaaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccggacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgcttcggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcgcgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
ttcgagcccaacaaggagggcgacttcgtgctgcgcttcttctcagagaagagtgctggg
actgtggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcggtcgactttgacaatttcgtttgctgcctggtg
cggctagagaccatgttccgatttttcaaaactctggacacagatctggatggagttgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system