KEGG   Homo sapiens (human): 824Help
Entry
824               CDS       T01001                                 

Gene name
CAPN2, CANP2, CANPL2, CANPml, mCANP
Definition
(RefSeq) calpain 2
  KO
K03853  
calpain-2 [EC:3.4.22.53]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Focal adhesion
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    824 (CAPN2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    824 (CAPN2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    824 (CAPN2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    824 (CAPN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     824 (CAPN2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   824 (CAPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P17655(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1q41
AA seq 700 aa AA seqDB search
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcggccaagctggcgaaggaccgggaggcggccgaggggctgggctcc
cacgagagggccatcaagtacctcaaccaggactacgaggcgctgcggaacgagtgcctg
gaggccgggacgctcttccaggacccgtccttcccggccatcccctcggccctgggcttc
aaggagttggggccctactccagcaaaacccggggcatcgagtggaagcgccccacggag
atctgcgctgacccccagtttatcattggaggagccacccgcacagacatctgccaagga
gccctgggtgactgctggctgctggcagccattgcctccctcaccttgaatgaagaaatc
ctggctcgagtcgtccccctaaaccagagcttccaggaaaactatgcagggatctttcac
ttccagttctggcaatacggcgagtgggtggaggtggtggtggatgacaggctgcccacc
aaggacggggagctgctctttgtgcattcagccgaagggagcgagttctggagcgccctg
ctggagaaggcatacgccaagatcaacggatgctatgaagcgctatcagggggtgccacc
actgagggcttcgaagacttcaccggaggcattgctgagtggtatgagttgaagaagccc
cctcccaacctgttcaagatcatccagaaagctctgcaaaaaggctctctccttggctgc
tccatcgacatcaccagcgccgcggactcggaggccatcacgtttcagaagctggtgaag
gggcacgcgtactcggtcaccggagccgaggaggttgaaagtaacggaagcctacagaaa
ctgatccgcatccgaaatccctggggagaagtggagtggacagggcggtggaatgacaac
tgcccaagctggaacactatagacccagaggagagggaaaggctgaccagacggcatgaa
gatggagaattctggatgtctttcagtgacttcctgaggcactattcccgcctggagatc
tgtaacctgaccccagacactctcaccagcgatacctacaagaagtggaaactcaccaaa
atggatgggaactggaggcggggctccaccgcgggaggttgcaggaactacccgaacaca
ttctggatgaaccctcagtacctgatcaagctggaggaggaggatgaggacgaggaggat
ggggagagcggctgcaccttcctggtggggctcattcagaagcaccgacggcggcagagg
aagatgggcgaggacatgcacaccatcggctttggcatctatgaggttccagaggagtta
agtgggcagaccaacatccacctcagcaaaaacttcttcctgacgaatcgcgccagggag
cgctcagacaccttcatcaacctccgggaggtgctcaaccgcttcaagctgccgccagga
gagtacattctcgtgccttccaccttcgaacccaacaaggatggggatttctgcatccgg
gtcttttctgaaaagaaagctgactaccaagctgtcgatgatgaaatcgaggccaatctt
gaagagttcgacatcagcgaggatgacattgatgatggattcaggagactgtttgcccag
ttggcaggagaggatgcggagatctctgcctttgagctgcagaccatcctgagaagggtt
ctagcaaagcgccaagatatcaagtcagatggcttcagcatcgagacatgcaaaattatg
gttgacatgctagattcggacgggagtggcaagctggggctgaaggagttctacattctc
tggacgaagattcaaaaataccaaaaaatttaccgagaaatcgacgttgacaggtctggt
accatgaattcctatgaaatgcggaaggcattagaagaagcaggtttcaagatgccctgt
caactccaccaagtcatcgttgctcggtttgcagatgaccagctcatcatcgattttgat
aattttgttcggtgtttggttcggctggaaacgctattcaagatatttaagcagctggat
cccgagaatactggaacaatagagctcgaccttatctcttggctctgtttctcagtactt
tga

DBGET integrated database retrieval system