KEGG   Homo sapiens (human): 824Help
Entry
824               CDS       T01001                                 

Gene name
CAPN2, CANP2, CANPL2, CANPml, mCANP
Definition
(RefSeq) calpain 2 (EC:3.4.22.53)
  KO
K03853  
calpain-2 [EC:3.4.22.53]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Focal adhesion
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    824 (CAPN2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    824 (CAPN2)
  Cellular commiunity
   04510 Focal adhesion
    824 (CAPN2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    824 (CAPN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     824 (CAPN2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   824 (CAPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41-q42
AA seq 700 aa AA seqDB search
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcggccaagctggcgaaggaccgggaggcggccgaggggctgggctcc
cacgagagggccatcaagtacctcaaccaggactacgaggcgctgcggaacgagtgcctg
gaggccgggacgctcttccaggacccgtccttcccggccatcccctcggccctgggcttc
aaggagttggggccctactccagcaaaacccggggcatcgagtggaagcgccccacggag
atctgcgctgacccccagtttatcattggaggagccacccgcacagacatctgccaagga
gccctgggtgactgctggctgctggcagccattgcctccctcaccttgaatgaagaaatc
ctggctcgagtcgtccccctaaaccagagcttccaggaaaactatgcagggatctttcac
ttccagttctggcaatacggcgagtgggtggaggtggtggtggatgacaggctgcccacc
aaggacggggagctgctctttgtgcattcagccgaagggagcgagttctggagcgccctg
ctggagaaggcatacgccaagatcaacggatgctatgaagcgctatcagggggtgccacc
actgagggcttcgaagacttcaccggaggcattgctgagtggtatgagttgaagaagccc
cctcccaacctgttcaagatcatccagaaagctctgcaaaaaggctctctccttggctgc
tccatcgacatcaccagcgccgcggactcggaggccatcacgtttcagaagctggtgaag
gggcacgcgtactcggtcaccggagccgaggaggttgaaagtaacggaagcctacagaaa
ctgatccgcatccgaaatccctggggagaagtggagtggacagggcggtggaatgacaac
tgcccaagctggaacactatagacccagaggagagggaaaggctgaccagacggcatgaa
gatggagaattctggatgtctttcagtgacttcctgaggcactattcccgcctggagatc
tgtaacctgaccccagacactctcaccagcgatacctacaagaagtggaaactcaccaaa
atggatgggaactggaggcggggctccaccgcgggaggttgcaggaactacccgaacaca
ttctggatgaaccctcagtacctgatcaagctggaggaggaggatgaggacgaggaggat
ggggagagcggctgcaccttcctggtggggctcattcagaagcaccgacggcggcagagg
aagatgggcgaggacatgcacaccatcggctttggcatctatgaggttccagaggagtta
agtgggcagaccaacatccacctcagcaaaaacttcttcctgacgaatcgcgccagggag
cgctcagacaccttcatcaacctccgggaggtgctcaaccgcttcaagctgccgccagga
gagtacattctcgtgccttccaccttcgaacccaacaaggatggggatttctgcatccgg
gtcttttctgaaaagaaagctgactaccaagctgtcgatgatgaaatcgaggccaatctt
gaagagttcgacatcagcgaggatgacattgatgatggattcaggagactgtttgcccag
ttggcaggagaggatgcggagatctctgcctttgagctgcagaccatcctgagaagggtt
ctagcaaagcgccaagatatcaagtcagatggcttcagcatcgagacatgcaaaattatg
gttgacatgctagattcggacgggagtggcaagctggggctgaaggagttctacattctc
tggacgaagattcaaaaataccaaaaaatttaccgagaaatcgacgttgacaggtctggt
accatgaattcctatgaaatgcggaaggcattagaagaagcaggtttcaagatgccctgt
caactccaccaagtcatcgttgctcggtttgcagatgaccagctcatcatcgattttgat
aattttgttcggtgtttggttcggctggaaacgctattcaagatatttaagcagctggat
cccgagaatactggaacaatagagctcgaccttatctcttggctctgtttctcagtactt
tga

DBGET integrated database retrieval system