KEGG   Homo sapiens (human): 8294Help
Entry
8294              CDS       T01001                                 

Gene name
HIST1H4I, H4/m, H4FM, H4M
Definition
histone cluster 1, H4i
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8294 (HIST1H4I)
  Immune diseases
   05322 Systemic lupus erythematosus
    8294 (HIST1H4I)
  Substance dependence
   05034 Alcoholism
    8294 (HIST1H4I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggacgcggcaaaggaggtaagggcctggggaaagggggtgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggtatcaccaagccagccattcggcgccttgctcgc
cgcggcggcgtgaagcgcatttctggcctcatctatgaggagacccgcggagtgttgaag
gtgttcctggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag
acggtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc
ttcggcggctaa

DBGET integrated database retrieval system