KEGG   Homo sapiens (human): 8330Help
Entry
8330              CDS       T01001                                 

Gene name
HIST1H2AK, H2A/d, H2AFD
Definition
(RefSeq) histone cluster 1 H2A family member k
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    8330 (HIST1H2AK)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    8330 (HIST1H2AK)
  Substance dependence
   05034 Alcoholism
    8330 (HIST1H2AK)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8330 (HIST1H2AK)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8330 (HIST1H2AK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 8330
NCBI-ProteinID: NP_003501
OMIM: 602788
HGNC: 4726
Ensembl: ENSG00000275221
Vega: OTTHUMG00000016382
UniProt: P0C0S8 A4FTV9
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacgtggcaagcagggcggcaaagctcgcgccaaggctaagacccgttcttca
agggcgggtcttcagttcccagtgggccgagtgcaccgactgctccgcaagggcaactac
gctgagcgggtcggtgccggagcgccggtgtacctggcggcggtgttggagtacctaacc
gccgagatcctggaactggctggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgcttggtaaa
gtgaccatcgcccagggtggtgtcctgcccaatatccaggccgtgctgctgcctaagaaa
actgagagccaccacaaggccaagggcaagtag

DBGET integrated database retrieval system