KEGG   Homo sapiens (human): 8331Help
Entry
8331              CDS       T01001                                 

Gene name
HIST1H2AJ, H2A/E, H2AFE, dJ160A22.4
Definition
histone cluster 1, H2aj
Orthology
K11251  
histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Systemic lupus erythematosus
Class
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
6p22.1
AA seq 128 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKTK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct
cgggccgggcttcagtttcccgtaggccgagtgcatcgcctgctccgcaaaggcaactat
gcggagcgggtcggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacc
gccgagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatc
ccgcgtcacctccagctggccatccgcaacgatgaggagctcaacaagcttctgggcaaa
gtcaccatcgcacagggtggcgtcctgcccaacatccaggccgtgctgctgccaaagaaa
actgagagccaccacaagactaagtaa

DBGET integrated database retrieval system