KEGG   Homo sapiens (human): 8331Help
Entry
8331              CDS       T01001                                 

Gene name
HIST1H2AJ, H2A/E, H2AFE, dJ160A22.4
Definition
(RefSeq) histone cluster 1 H2A family member j
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    8331 (HIST1H2AJ)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    8331 (HIST1H2AJ)
  Substance dependence
   05034 Alcoholism
    8331 (HIST1H2AJ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8331 (HIST1H2AJ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8331 (HIST1H2AJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 8331
NCBI-ProteinID: NP_066544
OMIM: 602791
HGNC: 4727
Ensembl: ENSG00000276368
Vega: OTTHUMG00000014486
Pharos: Q99878(Tdark)
UniProt: Q99878
Position
6p22.1
AA seq 128 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKTK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct
cgggccgggcttcagtttcccgtaggccgagtgcatcgcctgctccgcaaaggcaactat
gcggagcgggtcggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacc
gccgagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatc
ccgcgtcacctccagctggccatccgcaacgatgaggagctcaacaagcttctgggcaaa
gtcaccatcgcacagggtggcgtcctgcccaacatccaggccgtgctgctgccaaagaaa
actgagagccaccacaagactaagtaa

DBGET integrated database retrieval system