KEGG   Homo sapiens (human): 834Help
Entry
834               CDS       T01001                                 

Gene name
CASP1, ICE, IL1BC, P45
Definition
(RefSeq) caspase 1 (EC:3.4.22.36)
  KO
K01370  
caspase 1 [EC:3.4.22.36]
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Legionellosis
Influenza A
Drug target
Belnacasan: 
Emricasan: 
Nivocasan: 
Pralnacasan: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    834 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    834 (CASP1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    834 (CASP1)
  Infectious diseases
   05132 Salmonella infection
    834 (CASP1)
   05133 Pertussis
    834 (CASP1)
   05134 Legionellosis
    834 (CASP1)
   05164 Influenza A
    834 (CASP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     834 (CASP1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   834 (CASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 404 aa AA seqDB search
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccgttccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaacaaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagggacgctgggactctcagcagatcaaacatctggaaattaccttaat
atgcaagactctcaaggagtactttcttcctttccagctcctcaggcagtgcaggacaac
ccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgctccctagaagaa
gctcaaaggatatggaaacaaaagtcggcagagatttatccaataatggacaagtcaagc
cgcacacgtcttgctctcattatctgcaatgaagaatttgacagtattcctagaagaact
ggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctggggtacagcgta
gatgtgaaaaaaaatctcactgcttcggacatgactacagagctggaggcatttgcacac
cgcccagagcacaagacctctgacagcacgttcctggtgttcatgtctcatggtattcgg
gaaggcatttgtgggaagaaacactctgagcaagtcccagatatactacaactcaatgca
atctttaacatgttgaataccaagaactgcccaagtttgaaggacaaaccgaaggtgatc
atcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaagattcagtagga
gtttctggaaacctatctttaccaactacagaagagtttgaggatgatgctattaagaaa
gcccacatagagaaggattttatcgctttctgctcttccacaccagataatgtttcttgg
agacatcccacaatgggctctgtttttattggaagactcattgaacatatgcaagaatat
gcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttcatttgagcagcca
gatggtagagcgcagatgcccaccactgaaagagtgactttgacaagatgtttctacctc
ttcccaggacattaa

DBGET integrated database retrieval system