KEGG   Homo sapiens (human): 8349Help
Entry
8349              CDS       T01001                                 

Gene name
HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ
Definition
histone cluster 2, H2be
Orthology
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8349 (HIST2H2BE)
  Immune diseases
   05322 Systemic lupus erythematosus
    8349 (HIST2H2BE)
  Substance dependence
   05034 Alcoholism
    8349 (HIST2H2BE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8349 (HIST2H2BE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggcaaaatccgctccggcccctaaaaagggctccaagaaagccgtcacc
aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaagagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system