KEGG   Homo sapiens (human): 8349Help
Entry
8349              CDS       T01001                                 

Gene name
HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ
Definition
(RefSeq) histone cluster 2 H2B family member e
  KO
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8349 (HIST2H2BE)
  Immune diseases
   05322 Systemic lupus erythematosus
    8349 (HIST2H2BE)
  Substance dependence
   05034 Alcoholism
    8349 (HIST2H2BE)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8349 (HIST2H2BE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8349 (HIST2H2BE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q16778(Tbio)
UniProt: 
Position
1q21.2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggcaaaatccgctccggcccctaaaaagggctccaagaaagccgtcacc
aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaagagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system