KEGG   Homo sapiens (human): 836Help
Entry
836               CDS       T01001                                 

Gene name
CASP3, CPP32, CPP32B, SCA-1
Definition
caspase 3, apoptosis-related cysteine peptidase (EC:3.4.22.56)
Orthology
K02187  
caspase 3 [EC:3.4.22.56]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Serotonergic synapse
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Epithelial cell signaling in Helicobacter pylori infection
Pertussis
Legionellosis
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Herpes simplex infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Viral myocarditis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    836 (CASP3)
   04668 TNF signaling pathway
    836 (CASP3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    836 (CASP3)
   04115 p53 signaling pathway
    836 (CASP3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    836 (CASP3)
  Nervous system
   04726 Serotonergic synapse
    836 (CASP3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    836 (CASP3)
   05206 MicroRNAs in cancer
    836 (CASP3)
   05205 Proteoglycans in cancer
    836 (CASP3)
   05203 Viral carcinogenesis
    836 (CASP3)
   05210 Colorectal cancer
    836 (CASP3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    836 (CASP3)
   05012 Parkinson's disease
    836 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    836 (CASP3)
   05016 Huntington's disease
    836 (CASP3)
  Cardiovascular diseases
   05416 Viral myocarditis
    836 (CASP3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    836 (CASP3)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    836 (CASP3)
   05133 Pertussis
    836 (CASP3)
   05134 Legionellosis
    836 (CASP3)
   05152 Tuberculosis
    836 (CASP3)
   05161 Hepatitis B
    836 (CASP3)
   05168 Herpes simplex infection
    836 (CASP3)
   05146 Amoebiasis
    836 (CASP3)
   05145 Toxoplasmosis
    836 (CASP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     836 (CASP3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   836 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q34
AA seq 277 aa AA seqDB search
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagaacactgaaaactcagtggattcaaaatccattaaaaatttggaaccaaagatc
atacatggaagcgaatcaatggactctggaatatccctggacaacagttataaaatggat
tatcctgagatgggtttatgtataataattaataataagaattttcataaaagcactgga
atgacatctcggtctggtacagatgtcgatgcagcaaacctcagggaaacattcagaaac
ttgaaatatgaagtcaggaataaaaatgatcttacacgtgaagaaattgtggaattgatg
cgtgatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc
catggtgaagaaggaataatttttggaacaaatggacctgttgacctgaaaaaaataaca
aactttttcagaggggatcgttgtagaagtctaactggaaaacccaaacttttcattatt
caggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgatgat
gacatggcgtgtcataaaataccagtggaggccgacttcttgtatgcatactccacagca
cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtcgctttgt
gccatgctgaaacagtatgccgacaagcttgaatttatgcacattcttacccgggttaac
cgaaaggtggcaacagaatttgagtccttttcctttgacgctacttttcatgcaaagaaa
cagattccatgtattgtttccatgctcacaaaagaactctatttttatcactaa

DBGET integrated database retrieval system