KEGG   Homo sapiens (human): 8362Help
Entry
8362              CDS       T01001                                 

Gene name
HIST1H4K, H4/d, H4F2iii, H4FD, dJ160A22.1
Definition
histone cluster 1, H4k
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

DBGET integrated database retrieval system