KEGG   Homo sapiens (human): 83660Help
Entry
83660             CDS       T01001                                 

Gene name
TLN2, ILWEQ
Definition
talin 2
Orthology
K06271  
talin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    83660 (TLN2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    83660 (TLN2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    83660 (TLN2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    83660 (TLN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83660 (TLN2)
  Exosomal proteins of other cancer cells
   83660 (TLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15-q21
AA seq 2542 aa AA seqDB search
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPEFKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atggtggccctgtccttaaagatttgtgtgcgccactgcaacgtggtgaagaccatgcag
tttgaaccatctacagctgtgtacgatgcgtgtcgagtcattcgggaacgggtgcctgag
gcacaaactgggcaagcttctgactatggactctttctttcggatgaagacccgaggaaa
gggatttggctggaagcgggcagaacactggattactacatgttgcggaatggggatatt
ttggaatataaaaagaaacagagacctcagaaaatccggatgctggatggatctgtgaag
acagtgatggtggatgattccaagactgtgggggagctcctggtcactatttgtagcaga
ataggaataacaaattatgaagaatactccttaatccaagaaactattgaagaaaagaaa
gaggaaggaacgggcacactcaaaaaagacaggacactgttacgagatgagaggaaaatg
gagaagttgaaggccaagctgcacacagatgatgacctaaattggctggatcacagccga
acattcagagaacaaggagtagatgaaaacgaaacgttgctgcttagacggaagttcttt
tactctgatcagaatgtagattcgagagaccccgtgcagctgaacttgctttatgttcag
gcacgggatgacatcctgaatggctctcaccctgtctccttcgagaaagcttgtgagttt
ggtggatttcaagcccagatacaatttggacctcatgtggaacataaacacaaacctgga
tttttagatctgaaggaattcctgcccaaagaatatatcaagcagagaggagctgaaaag
aggatctttcaggagcataagaactgcggagagatgagtgagatagaagccaaggtcaag
tacgtcaaactcgcacggtccctccgcacatatggcgtgtccttcttcctggtgaaggag
aagatgaaaggcaagaacaagctggtgcctcgcctgctggggatcaccaaagactcggtg
atgcgcgtggatgagaagaccaaggaagtgctgcaggagtggcccctcaccaccgtcaag
cgctgggcagcctcacccaagagcttcacactggattttggggagtatcaggaaagctac
tattcagtacaaaccaccgagggagagcagatatcccagctgattgcaggctacattgac
atcatcctgaaaaagaaacaaagtaaagatcgatttggactagaaggtgatgaggagtca
accatgttagaagagtccgtttccccaaaaaagtccaccatcttgcagcagcagttcaac
cggaccgggaaggcagagcacggctcagtggcgctgccggccgtgatgcgctcgggctcc
agcgggcctgagaccttcaacgttggcagcatgccctcgccacagcagcaggtcatggtt
gggcagatgcaccgaggccacatgccgccactgacctcagcccagcaggccctgatgggg
accatcaacacaagcatgcacgccgtccagcaggcccaggatgatctcagtgagctcgac
tcgctgccacctctcggccaggatatggcatctagggtatgggttcagaacaaagtcgac
gaatccaaacacgaaatccattctcaagttgatgctatcacggccggaacggcttcagtt
gttaacctcacagctggtgaccctgcagacactgactacacagctgtgggatgtgcgatc
accactatttcttccaacctgacggagatgtccaagggtgtgaagctattggccgccctc
atggatgatgaggtgggcagcggggaggacttgctcagagctgccaggaccctcgctggg
gcggtgtcagacttgctgaaagctgtgcagcctacttctggagagcctcgacagacagtt
ttgactgctgctggcagcatcggacaagccagtggggatcttctgagacagattggagag
aatgagactgatgagcgattccaggatgttttaatgagtttggccaaagctgttgccaat
gcagctgccatgttggtactaaaggcaaagaatgttgcccaagtggccgaagacactgtc
ctacagaacagggtaattgctgctgccacccagtgtgccctctccacctcccagcttgtg
gcatgtgccaaggttgtgagccccactattagctcccctgtgtgccaggagcagctgatt
gaagcagggaagctggtggaccgctcggtggagaactgtgtccgtgcctgccaggcggcc
actaccgatagtgagctcctgaagcaggtcagcgcagcggccagcgtggtcagccaggcc
ctccatgatctcctgcagcatgtgcggcagtttgccagccgaggcgagcccatcggccgc
tacgaccaggctactgacaccatcatgtgtgtcaccgagagcatcttcagctccatgggt
gacgctggtgaaatggtgcgccaggcgcgggttctggcccaagccacatcagacctcgtc
aatgccatgaggtcagatgcagaagccgaaatcgacatggagaattcaaagaagctcctg
gcagcagcaaaactcttagctgactccactgctcgcatggtggaagctgcaaagggggct
gcagccaacccagagaatgaggaccagcagcaaaggctgagagaagctgcagaaggcctc
cgggtagcaaccaacgcagctgcccagaatgctattaagaaaaaaattgtcaaccgactg
gaggttgcagccaagcaggccgcagcggcagccacacagaccatcgccgcctcccagaat
gcagctgtttccaacaagaaccctgcggcccagcagcagctggtccagagttgcaaggca
gtggctgatcacatccctcagctggtccagggagtgagggggagccaagctcaagctgaa
gacctgagtgcccagctggctctcatcatctccagccagaacttcctccagcctggaagc
aagatggtgtcctctgccaaagccgcagtgcccaccgtgagtgaccaggccgcagccatg
cagctgagccagtgtgccaagaacctggccaccagcttggcggagctgcgtaccgcctcg
cagaaggcccatgaagcttgtggtccgatggaaatcgattcagctctgaatacggtgcag
acgcttaagaatgaactgcaggatgccaagatggcagccgtggagagccagctgaagcca
cttccaggggaaacgctggaaaaatgtgctcaggacctgggaagcacatccaaggcggtg
ggctcctccatggcacagctgctgacctgtgctgctcaaggcaacgaacactacacaggg
gtggctgctagagagacggcccaagctctgaaaacactggcccaggccgcccgtggagtg
gctgcatcgacaaccgaccccgcggccgcccatgccatgttagattctgctcgagacgtg
atggagggctccgccatgctcattcaagaggccaagcaggccctgattgcacctggagat
gcagagcgtcaacaaagactggctcaggtggctaaagccgtctcacactccttgaataac
tgcgtaaattgcctccctgggcagaaggatgtggacgtggccttgaagagcatcggggag
tccagcaagaagctgcttgtggattcgctacctccaagcacgaagcctttccaggaagcc
cagagtgaactgaaccaggcagcagctgatctgaaccagtctgctggggaagtggtccat
gccacccggggccagagtggagagttggctgcagcctctggaaagttcagtgatgatttt
gatgaattcctcgatgctggcattgagatggctggccaagctcagacaaaagaagaccag
atccaagtgatagggaacctcaagaatatctcgatggcatccagcaagctgctgttagct
gccaagtctctctctgtagatccaggagctcccaatgcgaaaaatctcctggctgcagct
gcaagagctgtgacagagagcatcaatcaactcatcactctgtgtacccaacaagctccg
ggccagaaagagtgcgataatgccctgcgggagctcgagactgtgaaggggatgttggac
aatcctaatgaacctgttagtgacctctcttactttgactgcattgagagtgtgatggaa
aactccaaggttctgggtgaatcgatggcagggatttcacagaatgccaagaccggagac
ctccctgcctttggggaatgtgtggggattgcatccaaggctctctgtgggctgacagag
gctgcagcccaggctgcatacttggttggcatctctgatccaaacagccaggcaggccac
cagggcctggtggaccccatccagtttgccagggctaaccaggccatccagatggcatgc
cagaacttggtggaccctggcagcagcccatcacaggtcctgtcagccgccacaattgtt
gccaagcacacgtcagccttgtgcaatgcctgccgcatcgcctcatccaagacggccaac
ccagtagccaagaggcacttcgtccagtcagccaaggaagtcgccaacagcactgccaac
ctggtgaagaccatcaaggccctggatggggatttctctgaagacaaccgcaataagtgt
cgcatcgccaccgcacccttgattgaagctgtggagaacctgacagcgttcgcctcaaac
cctgagtttgtcagcattcctgcccagatcagctccgagggttcccaggcacaggaacca
atcctggtctcagccaagaccatgctggagagttcatcgtacctcattcgcactgcacgc
tctctggccatcaaccccaaagacccacccacctggtctgtactggctggacattcccat
acagtgtccgactccatcaagagtctcatcacttctatcagggacaaggcccctggacag
agggagtgtgattactccatcgatggcatcaaccggtgcatccgggacatcgagcaggcc
tcgctggccgccgtcagccagagcctggccacgagggacgacatctctgtggaggccctg
caggagcagctgacttcggtggtccaggaaatcggacaccttatcgatcccatcgccaca
gcggctcggggagaagcagctcagctgggacataaggtgacacaactggcaagctatttt
gagcccttgatcttagccgcagttggtgtggcctccaagattcttgatcatcagcagcag
atgacggtgctggaccagaccaagactctcgcagagtctgccttgcagatgttgtatgca
gccaaagaaggtggcggaaaccccaaggcacaacacacccatgacgccatcacagaggcc
gcccagttgatgaaggaagccgtggatgacatcatggtgacgctgaacgaagctgccagt
gaagtggggctggttgggggcatggtggacgccattgcagaagccatgagcaagctggat
gaaggcactcctccagaaccaaagggaacatttgtcgactatcagacgactgtggttaaa
tactccaaagccattgcggtgacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggactggcttcacaaatgaccagtgactatgggcacctggctttccag
ggccagatggcagcagccacggcggaaccagaggagatcggattccagattcgcactcgt
gtgcaggacctgggccacggctgtatcttcctggtgcagaaggcaggggccctccaggtc
tgccccacagacagctacaccaagagggagctgatcgaatgcgcccgtgccgtcacggaa
aaggtctccttggtgctctcggctctccaggccgggaacaaaggaacccaggcatgcatt
acagccgccaccgctgtgtctgggatcattgccgacctggacaccaccattatgtttgca
acagcggggacgctgaatgcagagaacagtgagaccttcgcagaccacagggagaacatt
ctcaagacggccaaggccttggtagaagacacgaaactacttgtgtcaggagctgcgtcc
actcctgacaagctggcccaggcggcccagtcctcagcagccaccatcacccagctcgca
gaagtggtcaagctgggggcagccagcctgggctccgacgaccccgagacccaggtggtt
ttgatcaatgccatcaaagatgtggccaaggccctttctgatctcatcagtgctaccaag
ggagctgccagcaagccagtggacgacccttccatgtaccagctcaagggggctgccaag
gtgatggtgaccaatgtcacctcgctcctcaagactgtaaaggcagtggaggatgaggcc
acccggggcaccagggcgcttgaggccacaattgaatgcataaagcaggagcttacggtg
ttccagtcaaaagacgtacctgaaaagacatcatcacctgaagaatccataaggatgacg
aaaggcatcaccatggcaacagccaaagccgtggcagctgggaactcatgtagacaggag
gacgtgattgctactgccaacctgagccggaaagccgtgtcagatatgttgacggcttgc
aagcaagcatccttccaccccgatgtcagtgacgaggtgagaaccagagccttgcgtttc
gggacggagtgcacccttggctacttggacctcctggagcacgtcttggtgattcttcag
aaaccaaccccagaattcaagcagcagctggccgctttctccaagcgagtcgccggcgct
gtgacagagctcatccaggcggcggaagccatgaaaggaacagagtgggtggatccagaa
gacccaactgtcattgcagaaacagagttactgggggctgcagcatccatcgaagctgct
gctaagaagttagagcaactgaagccaagagcaaaaccaaaacaagcggatgagaccctg
gactttgaggaacagatcttggaagctgctaaatccattgctgctgccacaagcgccctg
gtcaaatcggcctcagcagcccagagggagctggtggcccaaggaaaggtgggctccatc
cctgccaatgctgcagacgacggacagtggtcacaggggctgatttctgctgcccggatg
gtggcggctgcgaccagcagtctctgtgaggcggccaatgcctccgttcagggacacgcc
agcgaggagaagctcatctcatctgccaagcaggtcgccgcttccacggctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaggcggctacaggcggca
ggaaatgctgtgaaaagagcctcagacaatcttgtccgtgcagcccagaaggcagctttt
ggcaaagctgatgacgacgatgttgtagtgaaaaccaagtttgtggggggcattgctcag
atcatcgccgcccaggaagaaatgctaaagaaagagcgagaactggaagaagcaaggaaa
aaactggcccaaatccgccagcagcagtataagtttttacccaccgagctgagggaagat
gagggctaa

DBGET integrated database retrieval system