KEGG   Homo sapiens (human): 83660Help
Entry
83660             CDS       T01001                                 

Gene name
TLN2, ILWEQ
Definition
(RefSeq) talin 2
  KO
K06271  
talin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Focal adhesion
Platelet activation
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    83660 (TLN2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    83660 (TLN2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    83660 (TLN2)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    83660 (TLN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83660 (TLN2)
  Exosomal proteins of other cancer cells
   83660 (TLN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y4G6(Tbio)
UniProt: 
Position
15q22.2
AA seq 2542 aa AA seqDB search
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPEFKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
NT seq 7629 nt NT seq  +upstreamnt  +downstreamnt
atggtggccctgtccttaaagatttgtgtgcgccactgcaacgtggtgaagaccatgcag
tttgaaccatctacagctgtgtacgatgcgtgtcgagtcattcgggaacgggtgcctgag
gcacaaactgggcaagcttctgactatggactctttctttcggatgaagacccgaggaaa
gggatttggctggaagcgggcagaacactggattactacatgttgcggaatggggatatt
ttggaatataaaaagaaacagagacctcagaaaatccggatgctggatggatctgtgaag
acagtgatggtggatgattccaagactgtgggggagctcctggtcactatttgtagcaga
ataggaataacaaattatgaagaatactccttaatccaagaaactattgaagaaaagaaa
gaggaaggaacgggcacactcaaaaaagacaggacactgttacgagatgagaggaaaatg
gagaagttgaaggccaagctgcacacagatgatgacctaaattggctggatcacagccga
acattcagagaacaaggagtagatgaaaacgaaacgttgctgcttagacggaagttcttt
tactctgatcagaatgtagattcgagagaccccgtgcagctgaacttgctttatgttcag
gcacgggatgacatcctgaatggctctcaccctgtctccttcgagaaagcttgtgagttt
ggtggatttcaagcccagatacaatttggacctcatgtggaacataaacacaaacctgga
tttttagatctgaaggaattcctgcccaaagaatatatcaagcagagaggagctgaaaag
aggatctttcaggagcataagaactgcggagagatgagtgagatagaagccaaggtcaag
tacgtcaaactcgcacggtccctccgcacatatggcgtgtccttcttcctggtgaaggag
aagatgaaaggcaagaacaagctggtgcctcgcctgctggggatcaccaaagactcggtg
atgcgcgtggatgagaagaccaaggaagtgctgcaggagtggcccctcaccaccgtcaag
cgctgggcagcctcacccaagagcttcacactggattttggggagtatcaggaaagctac
tattcagtacaaaccaccgagggagagcagatatcccagctgattgcaggctacattgac
atcatcctgaaaaagaaacaaagtaaagatcgatttggactagaaggtgatgaggagtca
accatgttagaagagtccgtttccccaaaaaagtccaccatcttgcagcagcagttcaac
cggaccgggaaggcagagcacggctcagtggcgctgccggccgtgatgcgctcgggctcc
agcgggcctgagaccttcaacgttggcagcatgccctcgccacagcagcaggtcatggtt
gggcagatgcaccgaggccacatgccgccactgacctcagcccagcaggccctgatgggg
accatcaacacaagcatgcacgccgtccagcaggcccaggatgatctcagtgagctcgac
tcgctgccacctctcggccaggatatggcatctagggtatgggttcagaacaaagtcgac
gaatccaaacacgaaatccattctcaagttgatgctatcacggccggaacggcttcagtt
gttaacctcacagctggtgaccctgcagacactgactacacagctgtgggatgtgcgatc
accactatttcttccaacctgacggagatgtccaagggtgtgaagctattggccgccctc
atggatgatgaggtgggcagcggggaggacttgctcagagctgccaggaccctcgctggg
gcggtgtcagacttgctgaaagctgtgcagcctacttctggagagcctcgacagacagtt
ttgactgctgctggcagcatcggacaagccagtggggatcttctgagacagattggagag
aatgagactgatgagcgattccaggatgttttaatgagtttggccaaagctgttgccaat
gcagctgccatgttggtactaaaggcaaagaatgttgcccaagtggccgaagacactgtc
ctacagaacagggtaattgctgctgccacccagtgtgccctctccacctcccagcttgtg
gcatgtgccaaggttgtgagccccactattagctcccctgtgtgccaggagcagctgatt
gaagcagggaagctggtggaccgctcggtggagaactgtgtccgtgcctgccaggcggcc
actaccgatagtgagctcctgaagcaggtcagcgcagcggccagcgtggtcagccaggcc
ctccatgatctcctgcagcatgtgcggcagtttgccagccgaggcgagcccatcggccgc
tacgaccaggctactgacaccatcatgtgtgtcaccgagagcatcttcagctccatgggt
gacgctggtgaaatggtgcgccaggcgcgggttctggcccaagccacatcagacctcgtc
aatgccatgaggtcagatgcagaagccgaaatcgacatggagaattcaaagaagctcctg
gcagcagcaaaactcttagctgactccactgctcgcatggtggaagctgcaaagggggct
gcagccaacccagagaatgaggaccagcagcaaaggctgagagaagctgcagaaggcctc
cgggtagcaaccaacgcagctgcccagaatgctattaagaaaaaaattgtcaaccgactg
gaggttgcagccaagcaggccgcagcggcagccacacagaccatcgccgcctcccagaat
gcagctgtttccaacaagaaccctgcggcccagcagcagctggtccagagttgcaaggca
gtggctgatcacatccctcagctggtccagggagtgagggggagccaagctcaagctgaa
gacctgagtgcccagctggctctcatcatctccagccagaacttcctccagcctggaagc
aagatggtgtcctctgccaaagccgcagtgcccaccgtgagtgaccaggccgcagccatg
cagctgagccagtgtgccaagaacctggccaccagcttggcggagctgcgtaccgcctcg
cagaaggcccatgaagcttgtggtccgatggaaatcgattcagctctgaatacggtgcag
acgcttaagaatgaactgcaggatgccaagatggcagccgtggagagccagctgaagcca
cttccaggggaaacgctggaaaaatgtgctcaggacctgggaagcacatccaaggcggtg
ggctcctccatggcacagctgctgacctgtgctgctcaaggcaacgaacactacacaggg
gtggctgctagagagacggcccaagctctgaaaacactggcccaggccgcccgtggagtg
gctgcatcgacaaccgaccccgcggccgcccatgccatgttagattctgctcgagacgtg
atggagggctccgccatgctcattcaagaggccaagcaggccctgattgcacctggagat
gcagagcgtcaacaaagactggctcaggtggctaaagccgtctcacactccttgaataac
tgcgtaaattgcctccctgggcagaaggatgtggacgtggccttgaagagcatcggggag
tccagcaagaagctgcttgtggattcgctacctccaagcacgaagcctttccaggaagcc
cagagtgaactgaaccaggcagcagctgatctgaaccagtctgctggggaagtggtccat
gccacccggggccagagtggagagttggctgcagcctctggaaagttcagtgatgatttt
gatgaattcctcgatgctggcattgagatggctggccaagctcagacaaaagaagaccag
atccaagtgatagggaacctcaagaatatctcgatggcatccagcaagctgctgttagct
gccaagtctctctctgtagatccaggagctcccaatgcgaaaaatctcctggctgcagct
gcaagagctgtgacagagagcatcaatcaactcatcactctgtgtacccaacaagctccg
ggccagaaagagtgcgataatgccctgcgggagctcgagactgtgaaggggatgttggac
aatcctaatgaacctgttagtgacctctcttactttgactgcattgagagtgtgatggaa
aactccaaggttctgggtgaatcgatggcagggatttcacagaatgccaagaccggagac
ctccctgcctttggggaatgtgtggggattgcatccaaggctctctgtgggctgacagag
gctgcagcccaggctgcatacttggttggcatctctgatccaaacagccaggcaggccac
cagggcctggtggaccccatccagtttgccagggctaaccaggccatccagatggcatgc
cagaacttggtggaccctggcagcagcccatcacaggtcctgtcagccgccacaattgtt
gccaagcacacgtcagccttgtgcaatgcctgccgcatcgcctcatccaagacggccaac
ccagtagccaagaggcacttcgtccagtcagccaaggaagtcgccaacagcactgccaac
ctggtgaagaccatcaaggccctggatggggatttctctgaagacaaccgcaataagtgt
cgcatcgccaccgcacccttgattgaagctgtggagaacctgacagcgttcgcctcaaac
cctgagtttgtcagcattcctgcccagatcagctccgagggttcccaggcacaggaacca
atcctggtctcagccaagaccatgctggagagttcatcgtacctcattcgcactgcacgc
tctctggccatcaaccccaaagacccacccacctggtctgtactggctggacattcccat
acagtgtccgactccatcaagagtctcatcacttctatcagggacaaggcccctggacag
agggagtgtgattactccatcgatggcatcaaccggtgcatccgggacatcgagcaggcc
tcgctggccgccgtcagccagagcctggccacgagggacgacatctctgtggaggccctg
caggagcagctgacttcggtggtccaggaaatcggacaccttatcgatcccatcgccaca
gcggctcggggagaagcagctcagctgggacataaggtgacacaactggcaagctatttt
gagcccttgatcttagccgcagttggtgtggcctccaagattcttgatcatcagcagcag
atgacggtgctggaccagaccaagactctcgcagagtctgccttgcagatgttgtatgca
gccaaagaaggtggcggaaaccccaaggcacaacacacccatgacgccatcacagaggcc
gcccagttgatgaaggaagccgtggatgacatcatggtgacgctgaacgaagctgccagt
gaagtggggctggttgggggcatggtggacgccattgcagaagccatgagcaagctggat
gaaggcactcctccagaaccaaagggaacatttgtcgactatcagacgactgtggttaaa
tactccaaagccattgcggtgacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggactggcttcacaaatgaccagtgactatgggcacctggctttccag
ggccagatggcagcagccacggcggaaccagaggagatcggattccagattcgcactcgt
gtgcaggacctgggccacggctgtatcttcctggtgcagaaggcaggggccctccaggtc
tgccccacagacagctacaccaagagggagctgatcgaatgcgcccgtgccgtcacggaa
aaggtctccttggtgctctcggctctccaggccgggaacaaaggaacccaggcatgcatt
acagccgccaccgctgtgtctgggatcattgccgacctggacaccaccattatgtttgca
acagcggggacgctgaatgcagagaacagtgagaccttcgcagaccacagggagaacatt
ctcaagacggccaaggccttggtagaagacacgaaactacttgtgtcaggagctgcgtcc
actcctgacaagctggcccaggcggcccagtcctcagcagccaccatcacccagctcgca
gaagtggtcaagctgggggcagccagcctgggctccgacgaccccgagacccaggtggtt
ttgatcaatgccatcaaagatgtggccaaggccctttctgatctcatcagtgctaccaag
ggagctgccagcaagccagtggacgacccttccatgtaccagctcaagggggctgccaag
gtgatggtgaccaatgtcacctcgctcctcaagactgtaaaggcagtggaggatgaggcc
acccggggcaccagggcgcttgaggccacaattgaatgcataaagcaggagcttacggtg
ttccagtcaaaagacgtacctgaaaagacatcatcacctgaagaatccataaggatgacg
aaaggcatcaccatggcaacagccaaagccgtggcagctgggaactcatgtagacaggag
gacgtgattgctactgccaacctgagccggaaagccgtgtcagatatgttgacggcttgc
aagcaagcatccttccaccccgatgtcagtgacgaggtgagaaccagagccttgcgtttc
gggacggagtgcacccttggctacttggacctcctggagcacgtcttggtgattcttcag
aaaccaaccccagaattcaagcagcagctggccgctttctccaagcgagtcgccggcgct
gtgacagagctcatccaggcggcggaagccatgaaaggaacagagtgggtggatccagaa
gacccaactgtcattgcagaaacagagttactgggggctgcagcatccatcgaagctgct
gctaagaagttagagcaactgaagccaagagcaaaaccaaaacaagcggatgagaccctg
gactttgaggaacagatcttggaagctgctaaatccattgctgctgccacaagcgccctg
gtcaaatcggcctcagcagcccagagggagctggtggcccaaggaaaggtgggctccatc
cctgccaatgctgcagacgacggacagtggtcacaggggctgatttctgctgcccggatg
gtggcggctgcgaccagcagtctctgtgaggcggccaatgcctccgttcagggacacgcc
agcgaggagaagctcatctcatctgccaagcaggtcgccgcttccacggctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaggcggctacaggcggca
ggaaatgctgtgaaaagagcctcagacaatcttgtccgtgcagcccagaaggcagctttt
ggcaaagctgatgacgacgatgttgtagtgaaaaccaagtttgtggggggcattgctcag
atcatcgccgcccaggaagaaatgctaaagaaagagcgagaactggaagaagcaaggaaa
aaactggcccaaatccgccagcagcagtataagtttttacccaccgagctgagggaagat
gagggctaa

DBGET integrated database retrieval system