KEGG   Homo sapiens (human): 8368Help
Entry
8368              CDS       T01001                                 

Gene name
HIST1H4L, H4.k, H4/k, H4FK
Definition
histone cluster 1, H4l
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8368 (HIST1H4L)
  Immune diseases
   05322 Systemic lupus erythematosus
    8368 (HIST1H4L)
  Substance dependence
   05034 Alcoholism
    8368 (HIST1H4L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p22.1
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggcgcggcaaaggcgggaagggtctgggcaaaggaggcgctaagcgccaccgc
aaagttctgcgcgacaacattcagggcatcaccaagcccgccatccgacgcctggcacgg
cgtggaggcgttaagcgcatctcaggccttatatacgaggagacacgcggagttcttaaa
gtgtttttggagaatgtaatccgcgatgcagttacctacacggagcacgccaaacgcaag
acagtcacagccatggacgtggtttacgcgctcaagcgccagggccgcaccctgtatggc
tttggcggctga

DBGET integrated database retrieval system