KEGG   Homo sapiens (human): 8369Help
Entry
8369              CDS       T01001                                 

Gene name
HIST1H4G, H4/l, H4FL
Definition
histone cluster 1, H4g
Orthology
K11254  
histone H4
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8369 (HIST1H4G)
  Immune diseases
   05322 Systemic lupus erythematosus
    8369 (HIST1H4G)
  Substance dependence
   05034 Alcoholism
    8369 (HIST1H4G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
6p22.1
AA seq 98 aa AA seqDB search
MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFK
VFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcggggcaaggccggaaaaggccttgggaaaggcggtgccaagtgccatcgc
aaggtactgagcgataatattcagggcattaccaagtgcactatccggcgcttggcccgg
catggcggtgtcaagcgcatcttgggcctcatttatgaggagacccgccgggtgttcaag
gtgttcctggaaaatgtgatctggtacgccgtgaccaacacggagcacgccaagcgcaag
acggtcaccgccatggccgtggtctacgtgctcaaacgccagggaagaaccctgtaa

DBGET integrated database retrieval system