KEGG   Homo sapiens (human): 839Help
Entry
839               CDS       T01001                                 

Gene name
CASP6, MCH2
Definition
caspase 6, apoptosis-related cysteine peptidase (EC:3.4.22.59)
Orthology
K04396  
caspase 6 [EC:3.4.22.59]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Class
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q25
AA seq 293 aa AA seqDB search
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS
HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN
QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG
SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggcctcggggctccgcagggggcacccggcaggtggggaagaaaacatgaca
gaaacagatgccttctataaaagagaaatgtttgatccggcagaaaagtacaaaatggac
cacaggaggagaggaattgctttaatcttcaatcatgagaggttcttttggcacttaaca
ctgccagaaaggcggggcacctgcgcagatagagacaatcttacccgcaggttttcagat
ctaggatttgaagtgaaatgctttaatgatcttaaagcagaagaactactgctcaaaatt
catgaggtgtcaactgttagccacgcagatgccgattgctttgtgtgtgtcttcctgagc
catggcgaaggcaatcacatttatgcatatgatgctaaaatcgaaattcagacattaact
ggcttgttcaaaggagacaagtgtcacagcctggttggaaaacccaagatatttatcatt
caggcatgtcggggaaaccagcacgatgtgccagtcattcctttggatgtagtagataat
cagacagagaagttggacaccaacataactgaggtggatgcagcctccgtttacacgctg
cctgctggagctgacttcctcatgtgttactctgttgcagaaggatattattctcaccgg
gaaactgtgaacggctcatggtacattcaagatttgtgtgagatgttgggaaaatatggc
tcctccttagagttcacagaactcctcacactggtgaacaggaaagtttctcagcgccga
gtggacttttgcaaagacccaagtgcaattggaaagaagcaggttccctgttttgcctca
atgctaactaaaaagctgcatttctttccaaaatctaattaa

DBGET integrated database retrieval system