KEGG   Homo sapiens (human): 8398Help
Entry
8398              CDS       T01001                                 

Gene name
PLA2G6, CaI-PLA2, GVI, INAD1, IPLA2-VIA, NBIA2, NBIA2A, NBIA2B, PARK14, PLA2, PNPLA9, iPLA2, iPLA2beta
Definition
phospholipase A2, group VI (cytosolic, calcium-independent) (EC:3.1.1.4)
Orthology
K16343  
calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Fc gamma R-mediated phagocytosis
Inflammatory mediator regulation of TRP channels
Disease
H00057  
Parkinson's disease (PD)
H00833  
Neurodegeneration with brain iron accumulation (NBIA)
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hsa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 752 aa AA seqDB search
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK
RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSM
AYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPA
ELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG
LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNP
WELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVS
DTVLVNALWETEVYIYEHREEFQKLIQLLLSP
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctttggccgcctggtcaataccttcagtggcgtcaccaacttgttctctaac
ccattccgggtgaaggaggtggctgtggccgactacacctcgagtgaccgagttcgggag
gaagggcagctgattctgttccagaacactcccaaccgcacctgggactgcgtcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggagttggaggctgacgcc
ctagtgaatttccatcagtattcttcccagctgctacccttctatgagagctcccctcag
gtcctgcacactgaggtcctgcagcacctgaccgacctcatccgtaaccaccccagctgg
tcagtggcccacctggctgtggagctagggatccgcgagtgcttccatcacagccgtatc
atcagctgtgccaattgcgcggagaacgaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatggggagatcctggtggagctggtgcagtactgccacactcagatggat
gtcaccgactacaagggagagaccgtcttccattatgctgtccagggtgacaattctcag
gtgctgcagctccttggaaggaacgcagtggctggcctgaaccaggtgaataaccaaggg
ctgaccccgctgcacctggcctgccagctggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgctcggtgcaacatcatgggccccaacggctaccccatccactcggccatg
aagttctctcagaaggggtgtgcggagatgatcatcagcatggacagcagccagatccac
agcaaagacccccgttacggagccagccccctccactgggccaagaacgcagagatggcc
cgcatgctgctgaaacggggctgcaacgtgaacagcaccagctccgcggggaacacggcc
ctgcacgtggcggtgatgcgcaaccgcttcgactgtgccatagtgctgctgacccacggg
gccaacgcggatgcccgcggagagcacggcaacaccccgctgcacctggccatgtcgaaa
gacaacgtggagatgatcaaggccctcatcgtgttcggagcagaagtggacaccccgaat
gactttggggagactcctacattcctagcctccaaaatcggcagacaactacaggatctc
atgcacatctcacgggcccggaagccagcgttcatcctgggctccatgagggacgagaag
cggacccacgaccacctgctgtgcctggatggaggaggagtgaaaggcctcatcatcatc
cagctcctcatcgccatcgagaaggcctcgggtgtggccaccaaggacctgtttgactgg
gtggcgggcaccagcactggaggcatcctggccctggccattctgcacagtaagtccatg
gcctacatgcgcggcatgtactttcgcatgaaggatgaggtgttccggggctccaggccc
tacgagtcggggcccctggaggagttcctgaagcgggagtttggggagcacaccaagatg
acggacgtcaggaaacccaaggtgatgctgacagggacactgtctgaccggcagccggct
gaactccacctcttccggaactacgatgctccagaaactgtccgggagcctcgtttcaac
cagaacgttaacctcaggcctccagctcagccctcagaccagctggtgtggcgggcggcc
cgaagcagcggggcagctcctacttacttccgacccaatgggcgcttcctggacggtggg
ctgctggccaacaaccccacgctggatgccatgaccgagatccatgagtacaatcaggac
ctgatccgcaagggtcaggccaacaaggtgaagaaactctccatcgttgtctccctgggg
acagggaggtccccacaagtgcctgtgacctgtgtggatgtcttccgtcccagcaacccc
tgggagctggccaagactgtttttggggccaaggaactgggcaagatggtggtggactgt
tgcacggatccagacgggcgggctgtggaccgggcacgggcctggtgcgagatggtcggc
atccagtacttcagattgaacccccagctggggacggacatcatgctggatgaggtcagt
gacacagtgctggtcaacgccctctgggagaccgaggtctacatctatgagcaccgcgag
gagttccagaagctcatccagctgctgctctcaccctga

DBGET integrated database retrieval system