KEGG   Homo sapiens (human): 8398Help
Entry
8398              CDS       T01001                                 

Gene name
PLA2G6, CaI-PLA2, GVI, INAD1, IPLA2-VIA, NBIA2, NBIA2A, NBIA2B, PARK14, PLA2, PNPLA9, iPLA2, iPLA2beta
Definition
phospholipase A2, group VI (cytosolic, calcium-independent) (EC:3.1.1.4)
Orthology
K16343  
calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Fc gamma R-mediated phagocytosis
Inflammatory mediator regulation of TRP channels
Disease
H00057  
Parkinson's disease (PD)
H00833  
Neurodegeneration with brain iron accumulation (NBIA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    8398 (PLA2G6)
   00565 Ether lipid metabolism
    8398 (PLA2G6)
   00590 Arachidonic acid metabolism
    8398 (PLA2G6)
   00591 Linoleic acid metabolism
    8398 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    8398 (PLA2G6)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8398 (PLA2G6)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8398 (PLA2G6)
  Circulatory system
   04270 Vascular smooth muscle contraction
    8398 (PLA2G6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8398 (PLA2G6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8398 (PLA2G6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 752 aa AA seqDB search
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK
RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSM
AYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPA
ELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG
LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNP
WELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVS
DTVLVNALWETEVYIYEHREEFQKLIQLLLSP
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctttggccgcctggtcaataccttcagtggcgtcaccaacttgttctctaac
ccattccgggtgaaggaggtggctgtggccgactacacctcgagtgaccgagttcgggag
gaagggcagctgattctgttccagaacactcccaaccgcacctgggactgcgtcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggagttggaggctgacgcc
ctagtgaatttccatcagtattcttcccagctgctacccttctatgagagctcccctcag
gtcctgcacactgaggtcctgcagcacctgaccgacctcatccgtaaccaccccagctgg
tcagtggcccacctggctgtggagctagggatccgcgagtgcttccatcacagccgtatc
atcagctgtgccaattgcgcggagaacgaggagggctgcacacccctgcacctggcctgc
cgcaagggtgatggggagatcctggtggagctggtgcagtactgccacactcagatggat
gtcaccgactacaagggagagaccgtcttccattatgctgtccagggtgacaattctcag
gtgctgcagctccttggaaggaacgcagtggctggcctgaaccaggtgaataaccaaggg
ctgaccccgctgcacctggcctgccagctggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgctcggtgcaacatcatgggccccaacggctaccccatccactcggccatg
aagttctctcagaaggggtgtgcggagatgatcatcagcatggacagcagccagatccac
agcaaagacccccgttacggagccagccccctccactgggccaagaacgcagagatggcc
cgcatgctgctgaaacggggctgcaacgtgaacagcaccagctccgcggggaacacggcc
ctgcacgtggcggtgatgcgcaaccgcttcgactgtgccatagtgctgctgacccacggg
gccaacgcggatgcccgcggagagcacggcaacaccccgctgcacctggccatgtcgaaa
gacaacgtggagatgatcaaggccctcatcgtgttcggagcagaagtggacaccccgaat
gactttggggagactcctacattcctagcctccaaaatcggcagacaactacaggatctc
atgcacatctcacgggcccggaagccagcgttcatcctgggctccatgagggacgagaag
cggacccacgaccacctgctgtgcctggatggaggaggagtgaaaggcctcatcatcatc
cagctcctcatcgccatcgagaaggcctcgggtgtggccaccaaggacctgtttgactgg
gtggcgggcaccagcactggaggcatcctggccctggccattctgcacagtaagtccatg
gcctacatgcgcggcatgtactttcgcatgaaggatgaggtgttccggggctccaggccc
tacgagtcggggcccctggaggagttcctgaagcgggagtttggggagcacaccaagatg
acggacgtcaggaaacccaaggtgatgctgacagggacactgtctgaccggcagccggct
gaactccacctcttccggaactacgatgctccagaaactgtccgggagcctcgtttcaac
cagaacgttaacctcaggcctccagctcagccctcagaccagctggtgtggcgggcggcc
cgaagcagcggggcagctcctacttacttccgacccaatgggcgcttcctggacggtggg
ctgctggccaacaaccccacgctggatgccatgaccgagatccatgagtacaatcaggac
ctgatccgcaagggtcaggccaacaaggtgaagaaactctccatcgttgtctccctgggg
acagggaggtccccacaagtgcctgtgacctgtgtggatgtcttccgtcccagcaacccc
tgggagctggccaagactgtttttggggccaaggaactgggcaagatggtggtggactgt
tgcacggatccagacgggcgggctgtggaccgggcacgggcctggtgcgagatggtcggc
atccagtacttcagattgaacccccagctggggacggacatcatgctggatgaggtcagt
gacacagtgctggtcaacgccctctgggagaccgaggtctacatctatgagcaccgcgag
gagttccagaagctcatccagctgctgctctcaccctga

DBGET integrated database retrieval system