KEGG   Homo sapiens (human): 8399Help
Entry
8399              CDS       T01001                                 

Gene name
PLA2G10, GXPLA2, GXSPLA2, SPLA2
Definition
phospholipase A2, group X (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    8399 (PLA2G10)
   00565 Ether lipid metabolism
    8399 (PLA2G10)
   00590 Arachidonic acid metabolism
    8399 (PLA2G10)
   00591 Linoleic acid metabolism
    8399 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    8399 (PLA2G10)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    8399 (PLA2G10)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    8399 (PLA2G10)
  Digestive system
   04972 Pancreatic secretion
    8399 (PLA2G10)
   04975 Fat digestion and absorption
    8399 (PLA2G10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8399 (PLA2G10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.1-p12
AA seq 165 aa AA seqDB search
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPI
AYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGP
AENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggggccgctacctgtgtgcctgccaatcatgctgctcctgctactgccgtcgctgctg
ctgctgctgcttctacctggccccgggtccggcgaggcctccaggatattacgtgtgcac
cggcgtgggatcctggaactggcaggaactgtgggttgtgttggtccccgaacccccatc
gcctatatgaaatatggttgcttttgtggcttgggaggccatggccagccccgcgatgcc
attgactggtgctgccatggccacgactgttgttacactcgagctgaggaggccggctgc
agccccaagacagagcgctactcctggcagtgcgtcaatcagagcgtcctgtgcggaccg
gcagagaacaaatgccaagaactgttgtgcaagtgtgaccaggagattgctaactgctta
gcccaaactgagtacaacttaaagtacctcttctacccccagttcctatgtgagccggac
tcgcccaagtgtgactga

DBGET integrated database retrieval system