KEGG   Homo sapiens (human): 841Help
Entry
841               CDS       T01001                                 

Gene name
CASP8, ALPS2B, CAP4, Casp-8, FLICE, MACH, MCH5
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05016  Huntington's disease
hsa05134  Legionellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05416  Viral myocarditis
Network
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00193  HPV E6 to host-cell-protein inhibition
N00202  KSHV vFLIP to host-cell-protein inhibition
Disease
H00108  Autoimmune lymphoproliferative syndromes (ALPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    841 (CASP8)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    841 (CASP8)
   04215 Apoptosis - multiple species
    841 (CASP8)
   04217 Necroptosis
    841 (CASP8)
   04115 p53 signaling pathway
    841 (CASP8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    841 (CASP8)
   04621 NOD-like receptor signaling pathway
    841 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    841 (CASP8)
   04625 C-type lectin receptor signaling pathway
    841 (CASP8)
   04657 IL-17 signaling pathway
    841 (CASP8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    841 (CASP8)
   05203 Viral carcinogenesis
    841 (CASP8)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    841 (CASP8)
   05016 Huntington's disease
    841 (CASP8)
  Cardiovascular diseases
   05416 Viral myocarditis
    841 (CASP8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    841 (CASP8)
  Infectious diseases
   05134 Legionellosis
    841 (CASP8)
   05152 Tuberculosis
    841 (CASP8)
   05161 Hepatitis B
    841 (CASP8)
   05168 Herpes simplex infection
    841 (CASP8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    841 (CASP8)
   05165 Human papillomavirus infection
    841 (CASP8)
   05145 Toxoplasmosis
    841 (CASP8)
   05142 Chagas disease (American trypanosomiasis)
    841 (CASP8)
  Drug resistance
   01524 Platinum drug resistance
    841 (CASP8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     841 (CASP8)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   841 (CASP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED PYRIN
Motif
Other DBs
NCBI-GeneID: 841
NCBI-ProteinID: NP_203519
OMIM: 601763
HGNC: 1509
Ensembl: ENSG00000064012
Vega: OTTHUMG00000132821
Pharos: Q14790(Tchem)
UniProt: Q14790
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 479 aa AA seqDB search
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggacttcagcagaaatctttatgatattggggaacaactggacagtgaagatctggcc
tccctcaagttcctgagcctggactacattccgcaaaggaagcaagaacccatcaaggat
gccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaatctgtcc
ttcctgaaggagctgctcttccgaattaatagactggatttgctgattacctacctaaac
actagaaaggaggagatggaaagggaacttcagacaccaggcagggctcaaatttctgcc
tacagggtcatgctctatcagatttcagaagaagtgagcagatcagaattgaggtctttt
aagtttcttttgcaagaggaaatctccaaatgcaaactggatgatgacatgaacctgctg
gatattttcatagagatggagaagagggtcatcctgggagaaggaaagttggacatcctg
aaaagagtctgtgcccaaatcaacaagagcctgctgaagataatcaacgactatgaagaa
ttcagcaaagagagaagcagcagccttgaaggaagtcctgatgaattttcaaatggggag
gagttgtgtggggtaatgacaatctcggactctccaagagaacaggatagtgaatcacag
actttggacaaagtttaccaaatgaaaagcaaacctcggggatactgtctgatcatcaac
aatcacaattttgcaaaagcacgggagaaagtgcccaaacttcacagcattagggacagg
aatggaacacacttggatgcaggggctttgaccacgacctttgaagagcttcattttgag
atcaagccccacgatgactgcacagtagagcaaatctatgagattttgaaaatctaccaa
ctcatggaccacagtaacatggactgcttcatctgctgtatcctctcccatggagacaag
ggcatcatctatggcactgatggacaggaggcccccatctatgagctgacatctcagttc
actggtttgaagtgcccttcccttgctggaaaacccaaagtgttttttattcaggcttgt
cagggggataactaccagaaaggtatacctgttgagactgattcagaggagcaaccctat
ttagaaatggatttatcatcacctcaaacgagatatatcccggatgaggctgactttctg
ctggggatggccactgtgaataactgtgtttcctaccgaaaccctgcagagggaacctgg
tacatccagtcactttgccagagcctgagagagcgatgtcctcgaggcgatgatattctc
accatcctgactgaagtgaactatgaagtaagcaacaaggatgacaagaaaaacatgggg
aaacagatgcctcagcctactttcacactaagaaaaaaacttgtcttcccttctgattga

DBGET integrated database retrieval system