KEGG   Homo sapiens (human): 842Help
Entry
842               CDS       T01001                                 

Gene name
CASP9, APAF-3, APAF3, ICE-LAP6, MCH6, PPP1R56
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04370  VEGF signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington's disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05416  Viral myocarditis
Module
hsa_M00685  Apoptotic machinery
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    842 (CASP9)
   04151 PI3K-Akt signaling pathway
    842 (CASP9)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    842 (CASP9)
   04215 Apoptosis - multiple species
    842 (CASP9)
   04115 p53 signaling pathway
    842 (CASP9)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    842 (CASP9)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    842 (CASP9)
   05210 Colorectal cancer
    842 (CASP9)
   05212 Pancreatic cancer
    842 (CASP9)
   05215 Prostate cancer
    842 (CASP9)
   05213 Endometrial cancer
    842 (CASP9)
   05222 Small cell lung cancer
    842 (CASP9)
   05223 Non-small cell lung cancer
    842 (CASP9)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    842 (CASP9)
   05012 Parkinson's disease
    842 (CASP9)
   05014 Amyotrophic lateral sclerosis (ALS)
    842 (CASP9)
   05016 Huntington's disease
    842 (CASP9)
  Cardiovascular diseases
   05416 Viral myocarditis
    842 (CASP9)
  Infectious diseases
   05134 Legionellosis
    842 (CASP9)
   05152 Tuberculosis
    842 (CASP9)
   05164 Influenza A
    842 (CASP9)
   05161 Hepatitis B
    842 (CASP9)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    842 (CASP9)
   05145 Toxoplasmosis
    842 (CASP9)
  Drug resistance
   01524 Platinum drug resistance
    842 (CASP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     842 (CASP9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     842 (CASP9)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   842 (CASP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD CARD_2 AsiA
Motif
Other DBs
NCBI-GeneID: 842
NCBI-ProteinID: NP_001220
OMIM: 602234
HGNC: 1511
Ensembl: ENSG00000132906
Vega: OTTHUMG00000002256
Pharos: P55211(Tchem)
UniProt: P55211
Structure
PDB: 

Jmol
Position
1p36.21
AA seq 416 aa AA seqDB search
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagcggatcggcggctcctgcggcggtgccggctgcggctggtggaagagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaggccccatatgatc
gaggacatccagcgggcaggctctggatctcggcgggatcaggccaggcagctgatcata
gatctggagactcgagggagtcaggctcttcctttgttcatctcctgcttagaggacaca
ggccaggacatgctggcttcgtttctgcgaactaacaggcaagcagcaaagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagagattcgcaaaccagaggtt
ctcagaccggaaacacccagaccagtggacattggttctggaggatttggtgatgtcggt
gctcttgagagtttgaggggaaatgcagatttggcttacatcctgagcatggagccctgt
ggccactgcctcattatcaacaatgtgaacttctgccgtgagtccgggctccgcacccgc
actggctccaacatcgactgtgagaagttgcggcgtcgcttctcctcgctgcatttcatg
gtggaggtgaagggcgacctgactgccaagaaaatggtgctggctttgctggagctggcg
cagcaggaccacggtgctctggactgctgcgtggtggtcattctctctcacggctgtcag
gccagccacctgcagttcccaggggctgtctacggcacagatggatgccctgtgtcggtc
gagaagattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggagcagaaagaccatgggtttgaggtggcctcc
acttcccctgaagacgagtcccctggcagtaaccccgagccagatgccaccccgttccag
gaaggtttgaggaccttcgaccagctggacgccatatctagtttgcccacacccagtgac
atctttgtgtcctactctactttcccaggttttgtttcctggagggaccccaagagtggc
tcctggtacgttgagaccctggacgacatctttgagcagtgggctcactctgaagacctg
cagtccctcctgcttagggtcgctaatgctgtttcggtgaaagggatttataaacagatg
cctggttgctttaatttcctccggaaaaaacttttctttaaaacatcataa

DBGET integrated database retrieval system