KEGG   Homo sapiens (human): 8445Help
Entry
8445              CDS       T01001                                 

Gene name
DYRK2
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     8445 (DYRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   8445 (DYRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q15
AA seq 528 aa AA seqDB search
MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRR
QGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQG
MTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMV
RNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIK
KNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSC
YEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLAC
MIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPES
REWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRI
TESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcacctgcatgtcggcagccacgctcacggacagatccaggttcaacagttg
tttgaggataacagtaacaagcggacagtgctcacgacacaaccaaatgggcttacaaca
gtgggcaaaacgggcttgccagtggtgccagagcggcagctggacagcattcatagacgg
caggggagctccacctctctaaagtccatggaaggcatggggaaggtgaaagccaccccc
atgacacctgaacaagcaatgaagcaatacatgcaaaaactcacagccttcgaacaccat
gagattttcagctaccctgaaatatatttcttgggtctaaatgctaagaagcgccagggc
atgacaggtgggcccaacaatggtggctatgatgatgaccagggatcatatgtgcaggtg
ccccacgatcacgtggcttacaggtatgaggtcctcaaggtcattgggaaggggagcttt
gggcaggtggtcaaggcctacgatcacaaagtccaccagcacgtggccctaaagatggtg
cggaatgagaagcgcttccaccggcaagcagcggaggagatccgaatcctggaacacctg
cggaagcaggacaaggataacacaatgaatgtcatccatatgctggagaatttcaccttc
cgcaaccacatctgcatgacgtttgagctgctgagcatgaacctctatgagctcatcaag
aagaataaattccagggcttcagtctgcctttggttcgcaagtttgcccactcgattctg
cagtgcttggatgctttgcacaaaaacagaataattcactgtgaccttaagcccgagaac
attttgttaaagcagcagggtagaagcggtattaaagtaattgattttggctccagttgt
tacgagcatcagcgtgtctacacgtacatccagtcgcgtttttaccgggctccagaagtg
atccttggggccaggtatggcatgcccattgatatgtggagcctgggctgcattttagca
gagctcctgacgggttaccccctcttgcctggggaagatgaaggggaccagctggcctgt
atgattgaactgttgggcatgccctcacagaaactgctggatgcatccaaacgagccaaa
aattttgtgagctccaagggttatccccgttactgcactgtcacgactctctcagatggc
tctgtggtcctaaacggaggccgttcccggagggggaaactgaggggcccaccggagagc
agagagtgggggaacgcgctgaaggggtgtgatgatccccttttccttgacttcttaaaa
cagtgtttagagtgggatcctgcagtgcgcatgaccccaggccaggctttgcggcacccc
tggctgaggaggcggttgccaaagcctcccaccggggagaaaacgtcagtgaaaaggata
actgagagcaccggtgctatcacatctatatccaagttacctccaccttctagctcagct
tccaaactgaggactaatttggcgcagatgacagatgccaatgggaatattcagcagagg
acagtgttgccaaaacttgttagctga

DBGET integrated database retrieval system