KEGG   Homo sapiens (human): 8449Help
Entry
8449              CDS       T01001                                 

Gene name
DHX16, DBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2
Definition
DEAH (Asp-Glu-Ala-His) box polypeptide 16 (EC:3.6.4.13)
Orthology
K12813  
pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    8449 (DHX16)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8449 (DHX16)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    8449 (DHX16)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    8449 (DHX16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 981 aa AA seqDB search
MSEDPRGPKVPRKAVVEKPARAAEREARALLEKNRSYRLLEDSEESSEETVSRAGSSLQK
KRKKRKHLRKKREEEEEEEASEKGKKKTGGSKQQTEKPESEDEWERTERERLQDLEERDA
FAERVRQRDKDRTRNVLERSDKKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKRER
EKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLAREYRAAGEQEKLEATNRYHM
PKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFGARDAASQEPKYQLVLEEE
ETIEFVRATQLQGDEEPSAPPTSTQAQQKESIQAVRRSLPVFPFREELLAAIANHQVLII
EGETGSGKTTQIPQYLFEEGYTNKGMKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYS
IRFEDCTSERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIKDVA
RFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAPEADYLEACVVSVL
QIHVTQPPGDILVFLTGQEEIEAACEMLQDRCRRLGSKIRELLVLPIYANLPSDMQARIF
QPTPPGARKVVVATNIAETSLTIEGIIYVLDPGFCKQKSYNPRTGMESLTVTPCSKASAN
QRAGRAGRVAAGKCFRLYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDF
LDPPPYETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYSCSEEI
LTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLLNVYTQWAESGYSSQWCYE
NFVQFRSMRRARDVREQLEGLLERVEVGLSSCQGDYIRVRKAITAGYFYHTARLTRSGYR
TVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKE
LEDPHAKKMPKKIGKTREELG
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagatcctagaggtcccaaggtaccacgaaaggcagtggtagaaaagccagct
cgggcagcagagcgagaggcccgggccctgctggagaagaaccgatcttataggttactg
gaagacagtgaagagagcagtgaggagactgtgagtagggctggaagcagcctccagaag
aaacgtaaaaagcggaaacacctcaggaagaagcgtgaggaagaagaggaggaagaggct
tctgagaaagggaagaagaaaacaggggggagtaaacagcagacagagaagccagagtcg
gaagatgagtgggaacggacagagcgtgaacgccttcaggacctggaggagcgtgatgcc
tttgctgagcgggttcgacagcgggacaaggatcggactcgaaatgtcctggaacggtca
gacaagaaggcttatgaagaggctcagaagcgcctcaagatggccgaggaagaccggaag
gccatggtccctgagctgcggaagaaatctcgccgagagtacctggctaagcgggagcga
gagaagcttgaggacctggaggcggagctggctgatgaggagttcctttttggggacgtg
gagctgagccggcacgagcggcaggagctcaaatataagcggcgagtgcgggatctcgcc
cgggagtaccgggcagctggggagcaggagaagctggaggccaccaatcgctaccacatg
cccaaggaaacccgaggacagccagcccgagctgtggatctagtggaggaggaatcagga
gcccctggggaggagcagcggcgctgggaggaggcgcggcttggggcagcgtccctgaag
tttggggcccgagatgctgcctctcaggagcccaagtatcaactggtgctggaggaggag
gagaccattgagtttgtccgggccactcagctccagggtgatgaggagccgtcagctcca
cccacttcaactcaggcccagcagaaagagtccatccaggccgtccgccgcagcctcccg
gtgttcccatttcgagaggagctcctggctgctattgcaaatcaccaagtcctcatcatt
gaaggcgagacaggctcagggaagaccacccagatcccgcagtatctctttgaggagggt
tatacaaacaagggtatgaagattgcctgcacccaaccccggagagtggctgccatgagt
gtggccgcccgagtggcccgggagatgggtgtgaagcttgggaatgaggttggctacagc
atccgctttgaggactgcacatcagagcgaactgtcctccgctacatgacagatgggatg
cttctccgggagttcctctctgagcctgacctggcgagttacagcgtggtgatggtggat
gaggcacacgaaaggaccctacacacagacattctctttggattgatcaaggatgttgct
cgcttccgacctgagctcaaggtcctggtggcttcagccacaatggacactgcccgtttt
tccaccttctttgatgacgcccctgtgtttcgaatccccggacgcaggtttcctgtggac
atcttctacaccaaggctccagaggctgactacttggaagcttgtgtagtatctgtgttg
cagatccatgtgacccagccccctggggatatcctggtgttcctgacaggacaggaggag
attgaggctgcctgtgagatgctccaggatcgctgccgccgcctgggctccaaaatccgg
gagctcctggtgctgcccatttatgccaatctgccctctgacatgcaggcccgtatcttc
cagcccacaccacctggggcacgaaaggtggttgtggcaacgaacattgctgagacatca
ctcaccattgagggcatcatttatgtgctggatccagggttctgtaagcagaagagctac
aacccccgcacaggcatggaatcgctcactgtcacaccctgcagcaaggcctcagccaat
cagcgagctggcagggcaggtcgggtggctgcagggaagtgcttccgcctgtataccgcc
tgggcctatcagcacgagcttgaggaaaccacagtgcctgagatccagaggaccagcttg
ggcaatgtcgtgttgctgctcaagagcttagggatccatgacctaatgcactttgatttc
ctggaccctccaccatatgagacactgctgctggctttggagcagctgtatgctctggga
gccctcaaccaccttggggagctcaccacgtctggtcgaaagatggcagagctgccggtg
gaccccatgctgtccaaaatgatcttagcctctgagaagtacagctgttcagaggagatc
ctgacagtggctgccatgctctctgtcaacaactccatcttctaccgaccaaaggacaag
gtcgtccatgctgacaatgcccgtgtcaacttctttctccctggcggtgaccacctggtt
ctgctaaatgtttacacacagtgggctgagagtggttactcttcccagtggtgctatgag
aactttgtacagttcagatcgatgcgccgagcccgggatgtgcgggaacagctggaaggg
ctcttggaacgtgtggaagttggtctcagttcctgccagggggactatatccgtgtacgc
aaggccatcactgctggttacttttaccacacggcacggttgactcggagtggctaccgc
acagtgaaacagcagcagacagtcttcattcatcccaactcctccctctttgagcaacag
ccacgctggctgctctaccacgaacttgtcttgaccaccaaagagttcatgagacaggta
ctggagattgagagcagttggcttctggaggtggctccccattattataaggccaaggag
ctagaagatccccatgctaagaaaatgcccaaaaaaataggcaaaacacgagaagagcta
gggtaa

DBGET integrated database retrieval system