KEGG   Homo sapiens (human): 8454Help
Entry
8454              CDS       T01001                                 

Gene name
CUL1
Definition
cullin 1
Orthology
K03347  
cullin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Herpes simplex infection
Module
SCF-BTRC complex
SCF-SKP2 complex
SCF-FBS complex
SCF-FBW7 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8454 (CUL1)
   04120 Ubiquitin mediated proteolysis
    8454 (CUL1)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    8454 (CUL1)
   04350 TGF-beta signaling pathway
    8454 (CUL1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8454 (CUL1)
   04114 Oocyte meiosis
    8454 (CUL1)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    8454 (CUL1)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    8454 (CUL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    Cullin
     8454 (CUL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 776 aa AA seqDB search
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacccggagccagaacccccacggcctgaagcagattggcctggaccagatc
tgggacgacctcagagccggcatccagcaggtgtacacacggcagagcatggccaagtcc
agatatatggagctctacactcatgtttataactactgtactagtgttcaccagtcaaac
caagcacgaggagctggagttcctccttctaagtcgaaaaaggggcagacacctggagga
gctcagtttgttggcctggaattatataaacgacttaaggaatttttgaagaattacttg
acaaatcttcttaaggatggagaagatttgatggatgagagtgtactgaaattctacact
caacaatgggaagattatcgattttcaagcaaagtgctgaatggaatttgtgcctacctc
aatagacattgggttcgccgtgaatgtgacgaaggacgaaaaggaatatatgaaatctat
tcgcttgcattggtgacttggagagactgtctgttcaggccactgaataaacaggtaaca
aatgctgttttaaagctgattgaaaaggaaaggaatggtgaaaccatcaatacaagattg
attagtggagttgtacagtcttacgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccagttactgaatat
atgaaaaaggcagaggctcgtctgcttgaggaacaacgaagagttcaggtttaccttcat
gaaagcacacaagatgaattagcaaggaaatgtgaacaagtcctcattgaaaaacacttg
gaaattttccacacagaatttcagaatttattggatgctgacaaaaatgaagatttggga
cgcatgtataatcttgtatctagaatccaggatggcctaggagaattgaaaaaactgttg
gagacacacattcataatcagggtcttgcagccattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtatgtacagacagtgcttgatgttcataaaaaatacaatgccctg
gtaatgtctgcattcaacaatgacgctggctttgtggctgctcttgataaggcttgtggt
cgcttcataaacaacaacgcggttaccaagatggcccaatcatccagtaaatcccctgag
ttgctggctcgatactgtgactccttgttgaagaaaagttccaagaacccagaggaggca
gaactagaagacacactcaatcaagtgatggttgtcttcaagtacatagaagacaaagac
gtatttcagaagttctatgcgaagatgctcgccaagaggctcgtccaccagaacagtgca
agtgacgatgccgaagccagcatgatctccaagttaaagcaagcttgcgggttcgagtac
acctctaaacttcagcgcatgtttcaagacattggcgtgagcaaagatctgaacgagcaa
ttcaaaaagcacttgacaaactcagaacccctagacttggatttcagcattcaagtgctg
agctccgggtcctggcccttccagcagtcttgtacatttgccttgccgtcagagttggaa
cgtagttatcagcgattcacagctttctacgccagccgccacagtggccgaaaattgacg
tggttatatcagttgtctaaaggagaattggtaactaactgcttcaaaaacagatatact
ttgcaggcgtcgacattccagatggctatcctgcttcagtacaacacggaagatgcctac
actgtgcagcagctgaccgacagcactcaaattaaaatggacattttggcgcaagtttta
cagattttattaaagtcgaagctattggtcttggaagatgaaaatgcaaatgttgatgag
gtggaattgaagccagataccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaaccgaacagaagcaggaacaagaaaccacacac
aaaaacatcgaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaag
atgaggaaggttctgaaacaccagcagttacttggcgaggtcctcactcagctgtcctcc
aggttcaaacctcgagtccctgtgatcaagaaatgcattgacattctaattgagaaagaa
tatttggagcgagtggatggtgaaaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system