KEGG   Homo sapiens (human): 8454Help
Entry
8454              CDS       T01001                                 

Gene name
CUL1
Definition
cullin 1
Orthology
K03347  
cullin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Wnt signaling pathway
TGF-beta signaling pathway
Circadian rhythm
Herpes simplex infection
Module
SCF-BTRC complex
SCF-SKP2 complex
SCF-FBS complex
SCF-FBW7 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 776 aa AA seqDB search
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacccggagccagaacccccacggcctgaagcagattggcctggaccagatc
tgggacgacctcagagccggcatccagcaggtgtacacacggcagagcatggccaagtcc
agatatatggagctctacactcatgtttataactactgtactagtgttcaccagtcaaac
caagcacgaggagctggagttcctccttctaagtcgaaaaaggggcagacacctggagga
gctcagtttgttggcctggaattatataaacgacttaaggaatttttgaagaattacttg
acaaatcttcttaaggatggagaagatttgatggatgagagtgtactgaaattctacact
caacaatgggaagattatcgattttcaagcaaagtgctgaatggaatttgtgcctacctc
aatagacattgggttcgccgtgaatgtgacgaaggacgaaaaggaatatatgaaatctat
tcgcttgcattggtgacttggagagactgtctgttcaggccactgaataaacaggtaaca
aatgctgttttaaagctgattgaaaaggaaaggaatggtgaaaccatcaatacaagattg
attagtggagttgtacagtcttacgtggaattggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagagagtactgaattcttgcagcagaacccagttactgaatat
atgaaaaaggcagaggctcgtctgcttgaggaacaacgaagagttcaggtttaccttcat
gaaagcacacaagatgaattagcaaggaaatgtgaacaagtcctcattgaaaaacacttg
gaaattttccacacagaatttcagaatttattggatgctgacaaaaatgaagatttggga
cgcatgtataatcttgtatctagaatccaggatggcctaggagaattgaaaaaactgttg
gagacacacattcataatcagggtcttgcagccattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtatgtacagacagtgcttgatgttcataaaaaatacaatgccctg
gtaatgtctgcattcaacaatgacgctggctttgtggctgctcttgataaggcttgtggt
cgcttcataaacaacaacgcggttaccaagatggcccaatcatccagtaaatcccctgag
ttgctggctcgatactgtgactccttgttgaagaaaagttccaagaacccagaggaggca
gaactagaagacacactcaatcaagtgatggttgtcttcaagtacatagaagacaaagac
gtatttcagaagttctatgcgaagatgctcgccaagaggctcgtccaccagaacagtgca
agtgacgatgccgaagccagcatgatctccaagttaaagcaagcttgcgggttcgagtac
acctctaaacttcagcgcatgtttcaagacattggcgtgagcaaagatctgaacgagcaa
ttcaaaaagcacttgacaaactcagaacccctagacttggatttcagcattcaagtgctg
agctccgggtcctggcccttccagcagtcttgtacatttgccttgccgtcagagttggaa
cgtagttatcagcgattcacagctttctacgccagccgccacagtggccgaaaattgacg
tggttatatcagttgtctaaaggagaattggtaactaactgcttcaaaaacagatatact
ttgcaggcgtcgacattccagatggctatcctgcttcagtacaacacggaagatgcctac
actgtgcagcagctgaccgacagcactcaaattaaaatggacattttggcgcaagtttta
cagattttattaaagtcgaagctattggtcttggaagatgaaaatgcaaatgttgatgag
gtggaattgaagccagataccttaataaaattatatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaaccgaacagaagcaggaacaagaaaccacacac
aaaaacatcgaggaagaccgcaaactactgattcaggcggccatcgtgagaatcatgaag
atgaggaaggttctgaaacaccagcagttacttggcgaggtcctcactcagctgtcctcc
aggttcaaacctcgagtccctgtgatcaagaaatgcattgacattctaattgagaaagaa
tatttggagcgagtggatggtgaaaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system