KEGG   Homo sapiens (human): 84617Help
Entry
84617             CDS       T01001                                 

Gene name
TUBB6, HsT1601, TUBB-5
Definition
tubulin, beta 6 class V
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.21
AA seq 446 aa AA seqDB search
MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYV
PRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVV
RKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDARNMM
AACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATANDGEEAFEDEEEEIDG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggcgggccagtgcgggaaccagatcggcaccaagttt
tgggaagtgatcagcgatgagcacggcatcgacccggccggaggctacgtgggagactcg
gcgctgcagctggagagaatcaacgtctactacaatgagtcatcgtctcagaaatatgtg
cccagggccgccctggtggacttagagccaggcaccatggacagcgtgcggtctgggcct
tttgggcagcttttccggcctgacaacttcatctttggccagacgggtgcagggaacaac
tgggcgaaagggcactacacggagggcgcggagctggtggacgcagtgctggacgtggtg
cggaaggagtgcgagcactgcgactgcctgcagggcttccagctcacgcactcgctgggc
ggcggcacgggctcaggcatgggcacgctgctcatcagcaagatccgtgaggagttcccg
gaccgcatcatgaacaccttcagcgtcatgccctcgcccaaggtgtcggacacggtggtg
gagccctacaatgccacactgtcggtgcaccagctggtggagaatacagacgagacctac
tgcatcgacaacgaggcgctctatgacatctgcttccgcactctgaagctgacaacgccc
acctacggggacctcaaccacctggtgtccgccaccatgagtggggtcaccacctcgctg
cgcttcccgggccagctcaatgctgacctgcgcaagctggcggtgaacatggtgcccttc
ccgcgcctgcacttcttcatgcctggcttcgcgccgctcaccagccgcggcagccagcag
taccgggccctgaccgtgcccgagctcacccagcagatgttcgacgccaggaacatgatg
gccgcctgcgatccgcgccatggccgctacctgaccgtggccaccgtgttccgcgggccc
atgtccatgaaggaggtggacgagcagatgctggccatccagagtaagaacagcagctac
ttcgtggagtggattcccaacaacgtgaaggtggccgtgtgcgacatcccgccccgcggc
ctgaagatggcctccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttctcagccatgttccggcgcaaggccttcctgcactggttcacgggt
gagggcatggatgaaatggagttcaccgaggcggagagcaacatgaacgacctggtatcc
gagtaccagcagtaccaggatgccaccgccaatgacggggaggaagcttttgaggatgag
gaagaggagatcgatggatag

DBGET integrated database retrieval system