KEGG   Homo sapiens (human): 84617Help
Entry
84617             CDS       T01001                                 

Gene name
TUBB6, HsT1601, TUBB-5
Definition
tubulin, beta 6 class V
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    84617 (TUBB6)
  Cellular commiunity
   04540 Gap junction
    84617 (TUBB6)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    84617 (TUBB6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84617 (TUBB6)
  Exosomal proteins of colorectal cancer cells
   84617 (TUBB6)
  Exosomal proteins of bladder cancer cells
   84617 (TUBB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.21
AA seq 446 aa AA seqDB search
MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLERINVYYNESSSQKYV
PRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHYTEGAELVDAVLDVV
RKECEHCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDARNMM
AACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMASTFIGNSTAIQELFKRISEQFSAMFRRKAFLHWFTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATANDGEEAFEDEEEEIDG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggcgggccagtgcgggaaccagatcggcaccaagttt
tgggaagtgatcagcgatgagcacggcatcgacccggccggaggctacgtgggagactcg
gcgctgcagctggagagaatcaacgtctactacaatgagtcatcgtctcagaaatatgtg
cccagggccgccctggtggacttagagccaggcaccatggacagcgtgcggtctgggcct
tttgggcagcttttccggcctgacaacttcatctttggccagacgggtgcagggaacaac
tgggcgaaagggcactacacggagggcgcggagctggtggacgcagtgctggacgtggtg
cggaaggagtgcgagcactgcgactgcctgcagggcttccagctcacgcactcgctgggc
ggcggcacgggctcaggcatgggcacgctgctcatcagcaagatccgtgaggagttcccg
gaccgcatcatgaacaccttcagcgtcatgccctcgcccaaggtgtcggacacggtggtg
gagccctacaatgccacactgtcggtgcaccagctggtggagaatacagacgagacctac
tgcatcgacaacgaggcgctctatgacatctgcttccgcactctgaagctgacaacgccc
acctacggggacctcaaccacctggtgtccgccaccatgagtggggtcaccacctcgctg
cgcttcccgggccagctcaatgctgacctgcgcaagctggcggtgaacatggtgcccttc
ccgcgcctgcacttcttcatgcctggcttcgcgccgctcaccagccgcggcagccagcag
taccgggccctgaccgtgcccgagctcacccagcagatgttcgacgccaggaacatgatg
gccgcctgcgatccgcgccatggccgctacctgaccgtggccaccgtgttccgcgggccc
atgtccatgaaggaggtggacgagcagatgctggccatccagagtaagaacagcagctac
ttcgtggagtggattcccaacaacgtgaaggtggccgtgtgcgacatcccgccccgcggc
ctgaagatggcctccaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttctcagccatgttccggcgcaaggccttcctgcactggttcacgggt
gagggcatggatgaaatggagttcaccgaggcggagagcaacatgaacgacctggtatcc
gagtaccagcagtaccaggatgccaccgccaatgacggggaggaagcttttgaggatgag
gaagaggagatcgatggatag

DBGET integrated database retrieval system