KEGG   Homo sapiens (human): 84647Help
Entry
84647             CDS       T01001                                 

Gene name
PLA2G12B, FKSG71, GXIIB, GXIIIsPLA2, PLA2G13, sPLA2-GXIIB
Definition
(RefSeq) phospholipase A2 group XIIB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    84647 (PLA2G12B)
   00565 Ether lipid metabolism
    84647 (PLA2G12B)
   00590 Arachidonic acid metabolism
    84647 (PLA2G12B)
   00591 Linoleic acid metabolism
    84647 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    84647 (PLA2G12B)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    84647 (PLA2G12B)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    84647 (PLA2G12B)
  Digestive system
   04972 Pancreatic secretion
    84647 (PLA2G12B)
   04975 Fat digestion and absorption
    84647 (PLA2G12B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     84647 (PLA2G12B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    84647 (PLA2G12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2G12
Motif
Other DBs
NCBI-GeneID: 84647
NCBI-ProteinID: NP_115951
OMIM: 611653
HGNC: 18555
Ensembl: ENSG00000138308
Vega: OTTHUMG00000018446
Pharos: Q9BX93(Tdark)
UniProt: Q9BX93
Position
10q22.1
AA seq 195 aa AA seqDB search
MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSKVEAACDSLVDTVFNTVWTLGCRPFMNS
QRAACICAEEEKEEL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggccagtggcttcttggttttgtggctcagccttgggggtggcctggctcag
agcgacacgagccctgacacggaggagtcctattcagactggggccttcggcacctccgg
ggaagctttgaatccgtcaatagctacttcgattcttttctggagctgctgggagggaag
aatggagtctgtcagtacaggtgccgatatggaaaggcaccaatgcccagacctggctac
aagccccaagagcccaatggctgcggctcctatttcctgggtctcaaggtaccagaaagt
atggacttgggcattccagcaatgacaaagtgctgcaaccagctggatgtctgttatgac
acttgcggtgccaacaaatatcgctgtgatgcaaaattccgatggtgtctccactcgatc
tgctctgaccttaagcggagtctgggctttgtctccaaagtggaagcagcctgtgattcc
ctggttgacactgtgttcaacaccgtgtggaccttgggctgccgcccctttatgaatagt
cagcgggcagcttgcatctgtgcagaggaggagaaggaagagttatga

DBGET integrated database retrieval system