KEGG   Homo sapiens (human): 84790Help
Entry
84790             CDS       T01001                                 

Gene name
TUBA1C, TUBA6, bcm948
Definition
(RefSeq) tubulin alpha 1c
  KO
K07374  tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04540  Gap junction
hsa05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    84790 (TUBA1C)
  Cell growth and death
   04210 Apoptosis
    84790 (TUBA1C)
  Cellular community - eukaryotes
   04530 Tight junction
    84790 (TUBA1C)
   04540 Gap junction
    84790 (TUBA1C)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    84790 (TUBA1C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     84790 (TUBA1C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     84790 (TUBA1C)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    84790 (TUBA1C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   84790 (TUBA1C)
  Exosomal proteins of other body fluids (saliva and urine)
   84790 (TUBA1C)
  Exosomal proteins of colorectal cancer cells
   84790 (TUBA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 84790
NCBI-ProteinID: NP_116093
HGNC: 20768
Ensembl: ENSG00000167553
Vega: OTTHUMG00000169497
Pharos: Q9BQE3(Tchem)
UniProt: Q9BQE3
Position
12q13.12
AA seq 449 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGADSADGEDEGEEY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgcatctccatccacgttggccaggctggtgtccagattggcaatgcctgc
tgggagctctactgcctggaacacggcatccagcccgatggccagatgccaagtgacaag
accattgggggaggagatgattccttcaacaccttcttcagtgaaacgggtgctggcaag
catgtgccccgggcagtgtttgtagacttggaacccacagtcattgatgaagttcgcact
ggcacttaccgccagctcttccaccctgagcaactcatcacaggcaaggaagatgctgcc
aataactatgcccgagggcactacaccattggcaaggagatcattgacctcgtgttggac
cgaattcgcaagctggctgaccagtgcaccggtcttcagggcttcttggttttccacagc
tttggtgggggaactggttctgggttcacctcgctgctcatggaacgtctctcagttgat
tatggcaagaagtccaagctggagttctccatttacccggcgccccaggtttccacagct
gtagttgagccctacaactccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgatatcgag
cgcccaacctacactaaccttaaccgccttattagccagattgtgtcctccatcactgct
tccctgagatttgatggagccctgaatgttgacctgacagaattccagaccaacctggtg
ccctacccccgcatccacttccctctggccacatatgcccctgtcatctctgctgagaaa
gcctaccacgaacagcttactgtagcagagatcaccaatgcttgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgttataccgt
ggtgacgtggttcccaaagatgtcaatgctgccattgccaccatcaaaaccaagcgtacc
atccagtttgtggattggtgccccactggcttcaaggttggcattaattaccagcctccc
actgtggtgcctggcggagacctggccaaggtacagagagctgtgtgcatgctgagcaat
accacagctgttgccgaggcctgggctcgcctggaccacaagtttgacctgatgtatgcc
aagcgtgcctttgttcactggtacgtgggtgaggggatggaggaaggcgagttttcagag
gcccgtgaggacatggctgcccttgagaaggattatgaggaggttggagcagatagtgct
gacggagaggatgagggtgaagagtattaa

DBGET integrated database retrieval system