KEGG   Homo sapiens (human): 84920Help
Entry
84920             CDS       T01001                                 

Gene name
ALG10, ALG10A, DIE2, KCR1
Definition
ALG10, alpha-1,2-glucosyltransferase (EC:2.4.1.256)
Orthology
K03850  
alpha-1,2-glucosyltransferase [EC:2.4.1.256]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    84920 (ALG10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.256  dolichyl-P-Glc:Glc2Man9GlcNAc2-PP-dolichol alpha-1,2-glucosyltransferase
     84920 (ALG10)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   84920 (ALG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
UniProt: 
Position
12p11.1
AA seq 473 aa AA seqDB search
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDP
MITTLPGLYLVSIGVIKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQP
RNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGF
CGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAY
SMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLF
FSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWK
RVFQRYETVKYLLVPAYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFIL
PYVIYRLNIPLPPTSRLICELSCYAVVNFITFFIFLNKTFQWPNSQDIQRFMW
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctggaaggttactatttctcggccgccttgagctgtacctttttagtatcc
tgcctcctcttctccgccttcagccgggcgttgcgagagccctacatggacgagatcttc
cacctgcctcaggcgcagcgctactgtgagggccatttctccctttcccagtgggatccc
atgattactacattacctggcttgtacctggtgtcaattggagtgatcaaacctgccatt
tggatctttggatggtctgaacatgttgtctgctccattgggatgctcagatttgttaat
cttctcttcagtgttggcaacttctatttactatatttgcttttctgcaaggtacaaccc
agaaacaaggctgcctcaagtatccagagagtcttgtcaacattaacactagcagtattt
ccaacactttatttttttaacttcctttattatacagaagcaggatctatgttttttact
ctttttgcgtatttgatgtgtctttatggaaatcataaaacttcagccttccttggattt
tgtggcttcatgtttcggcaaacaaatatcatctgggctgtcttctgtgcaggaaatgtc
attgcacaaaagttaacggaggcttggaaaactgagctacaaaagaaggaagacagactt
ccacctattaaaggaccatttgcagaattcagaaaaattcttcagtttcttttggcttat
tccatgtcctttaaaaacttgagtatgcttttgcttctgacttggccctacatccttctg
ggatttctgttttgtgcttttgtagtagttaatggtggaattgttattggcgatcggagt
agtcatgaagcctgtcttcattttcctcaactattctactttttttcatttactctcttt
ttttcctttcctcatctcctgtctcctagcaaaattaagacttttctttccttagtttgg
aaacgtagaattctgttttttgtggttaccttagtctctgtgtttttagtttggaaattc
acttatgctcataaatacttgctagcagacaatagacattatactttctatgtgtggaaa
agagtttttcaaagatatgaaactgtaaaatatttgttagttccagcctatatatttgct
ggttggagtatagctgactcattgaaatcaaagtcaattttttggaatttaatgtttttc
atatgcttgttcactgttatagttcctcagaaactgctggaatttcgttacttcatttta
ccttatgtcatttataggcttaacatacctctgcctcccacatccagactcatttgtgaa
ctgagctgctatgcagttgttaatttcataacttttttcatctttctgaacaagactttt
cagtggccaaatagtcaggacattcaaaggtttatgtggtaa

DBGET integrated database retrieval system